Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G15910-AT1G80790
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):XH/XS domain-containing protein
Function (paralog2):XH/XS domain-containing protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.65351794037804
Log2 mRNA fold difference:1.1060902707615
Log2 TE fold difference:-0.42990821004632
Sequences
Protein sequence

MSISDEEAEISESEIEDYSETPYRLLRDGTYKVKVNGQLRCPFCAGKKKQDYKYKELYAH
ATGVSKGSATRSALQKANHLALAMFLENELAGYAEPVPRPPVVPPQLDETEPNPHNVYVW
PWMGIVVNPLKEADDKELLLDSAYWLQTLSKFKPIEVNAFWVEQDSIVGVIAKFNGDWSG
FAGATELEKEFETQGSSKKEWTERSGDSESKAYGWCARADDFESQGPIGEYLSKEGQLRT
VSDISQKNVQDRNTVLEELSDMIAMTNEDLNKVQYSYNRTAMSLQRVLDEKKNLHQAFAD
ETKKMQQMSLRHIQKILYDKEKLSNELDRKMRDLESRAKQLEKHEALTELDRQKLDEDKR
KSDAMNKSLQLASREQKKADESVLRLVEEHQRQKEDALNKILLLEKQLDTKQTLEMEIQE
LKGKLQVMKHLGDDDDEAVQKKMKEMNDELDDKKAELEGLESMNSVLMTKERQSNDEIQA
ARKKLIAGLTGLLGAETDIGVKRMGELDEKPFLDVCKLRYSANEAAVEAATLCSTWQENL
KNPSWQPFKHEGTGDGAEEVVDEDDEQLKKLKREWGKEVHNAVKTALVEMNEYNASGRYT
TPELWNFKEGRKATLKEVITFISNDIKILKRKRT

MDNSSDEESEISESEIDVYYEKPYEKLMNGDYKVKVKDTFRCPFCAGKKKQHYKYKELLA
HASGVAKGSASRSAKQKANHFALAKYMENELAGDADVPRPQIPSSSTEQSQAVVDDIYVW
PWMGIVINPVRRTDNKNVLLDSAYWLKKLARFNPLEVKTLWLDQESVVAVIPQFNSGWSG
FKSVTELEKEYEIRGCGRKDWIDKRGDWRSKAYGWCARADDYNSQGSIAEYLSKVGKLRS
FSDITKEEIQNKSIVVDDLANKIAMTNEDLNKLQYMNNEKTLSLRRVLIEKDELDRVYKQ
ETKKMQELSREKINRIFREKERLTNELEAKMNNLKIWSKQLDKKQALTELERQKLDEDKK
KSDVMNSSLQLASLEQKKTDDRVLRLVDEHKRKKEETLNKILQLEKELDSKQKLQMEIQE
LKGKLKVMKHEDEDDEGIKKKMKKMKEELEEKCSELQDLEDTNSALMVKERKSNDEIVEA
RKFLITELRELVSDRNIIRVKRMGELEEKPFMTACRQRCTVEEEAQVQYAMLCSKWQEKV
KDSAWQPFKHVGTGDRKKEVVDEEDEEIKKLREEWGEEVKNAVKTALEELNEFNPSGRYS
VPELWNSKQGRKATLKEVIDYITQQVKTLKRRRA

Other information
Ka divergence:0.100278KaKs divergence:0.0315956
GC content 1 (%):44GC content 2 (%):43GC content divergence:-0.011
Length 1 (bp):1905Length 2 (bp):1905Length divergence:0
MFE 1 (kcal):-554.74MFE 2 (kcal):-528.08MFE divergence-0.025