Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G15940-AT1G80810
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Tudor/PWWP/MBT superfamily protein
Function (paralog2):Tudor/PWWP/MBT superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.50438357735719
Log2 mRNA fold difference:-0.85945173467984
Log2 TE fold difference:0.38281923162398
Sequences
Protein sequence

MGPLVEATEFSKEQALTDAAENLLKPHFSTDATLSLLEVMESLLATVEQDLSSSVQKALH
PPMRALVSADLLRNPDSDVRVSVVSCLTEIMRITAPEAPYNDEQMKDIFQVTIEAFEKLA
DASSRSYRKAEVILETVAKVRSSLVMLDLECDDLVLEMFQRFLKIIRPDHPQLVLVSMET
IMITVIDESEEVPMDLLEILLTTVKKDSQDVSPAALTLVEKVLSSCTCKLQPCIMEALKS
SGTSLDMYSPVVSSICQSEFATTQAHNDVKPKDNEADEKISEGQVVPSDSLEDKLNLGLS
RKGTRSKRSARGGTRRANGDEKVITANEGLSESTDAETASGSTRKRGWKPKSLMNPEEGY
SFKTSSSKKVQEKELGDSSLGKVAAKKVPLPSKVGQTNQSVVISLSSSGRARTGSRKRSR
TKMEETDHDVSSVATQPAKKQTVKKTNPAKEDLTKSNVKKHEDGIKTGKSSKKEKADNGL
AKTSAKKPLAETMMVKPSGKKLVHSDAKKKNSEGASMDTPIPQSSKSKKKDSRATTPATK
KSEQAPKSHPKMKRIAGEEVESNTNELGEELVGKRVNVWWPLDKKFYEGVIKSYCRVKKM
HQVTYSDGDVEELNLKKERFKIIEDKSSASEDKEDDLLESTPLSAFIQREKSKKRKIVSK
NVEPSSSPEVRSSMQTMKKKDSVTDSIKQTKRTKGALKAVSNEPESTTGKNLKSLKKLNG
EPDKTRGRTGKKQKVTQAMHRKIEKDCDEQEDLETKDEEDSLKLGKESDAEPDRMEDHQE
LPENHNVETKTDGEEQEAAKEPTAESKTNGEEPNAEPETDGKEHKSLKEPNAEPKSDGEE
QEAAKEPNAELKTDGENQEAAKELTAERKTDEEEHKVADEVEQKSQKETNVEPEAEGEEQ
KSVEEPNAEPKTKVEEKESAKEQTADTKLIEKEDMSKTKGEEIDKETYSSIPETGKVGNE
AEEDDQRVIKELEEESDKAEVSTTVLEVDP

MQSALIPSRNALVSVDLLSHPDSDVRVSVVSCLTEIVRITAPETPYSDDLMKEIFRLTIE
AFEKLADASSRSYKKAEFVLDNVAKVKSCLVMLDLECYDLILQMFRNFFKFIRSDHPQLV
FSSMELIMIAIIDETEQVSTDLLDSLLATVKKENQNVSPMSWSLAEKVLSRCARKLKPYI
IEALKSRGTSLDMYSPVVSSICQSVFNTPKVHSPVNTKEHEEKLDLGHSRKENLSKSSSK
RPARHETRGINEKEKVRNGNKSSLLKQSLKQVRSESTDAEITGKRGRKPNSLMNPEDYDI
SWLSGKRDPLKTSSNKKIQKKGSGGVSSLGKVPAKKTPLPKENSPATSSRSLTGSLKRSR
VKMDESDYDSDSLSSPRLKKLASCFRDEEPNQEDDRKIGNSSKQTRSKNGLEKSQKTAKK
KPVVEAKIVNSSGKRLSARSVAKRRNLERAPLDTLVPQSSKRKKMVSQVAARQLANESEE
ETPKSHPTRRRTVRKEVSDGFGEDLVGKRVNIWWPLDKTFYEGVIDSYCTRKKMHRVIYS
DGDSEELNLTEERWELLEDDTSADEQDKEIDLPESIPLSDIMQRQKVKKSKNVAVSVEPT
SSSGVRSSSRTLMKKDCGKRLNKQVEKTREGKNLRSLKELNAETDRTAEEQEVSLEAESD
DRSEEQEYEDDCSDKKEQSQDKGVEAETKEEEKQYPNSEGESEGEDSESEEEPKWRETDD
MEDDEEEEEEEIDHMEDEAEEEKEEVDDKEASANMSEIEKEEEEEEEDEEKRKS

Other information
Ka divergence:-0.148727KaKs divergence:0.736542
GC content 1 (%):42GC content 2 (%):41GC content divergence:-0.012
Length 1 (bp):2973Length 2 (bp):2325Length divergence:-0.122
MFE 1 (kcal):-851.01MFE 2 (kcal):-621.26MFE divergence-0.156