Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G15950-AT1G80820
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):cinnamoyl coa reductase 1
Function (paralog2):cinnamoyl coa reductase

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-3.949124967806
Log2 mRNA fold difference:-4.6134730304325
Log2 TE fold difference:0.60569829681032
Sequences
Protein sequence

MPVDVASPAGKTVCVTGAGGYIASWIVKILLERGYTVKGTVRNPDDPKNTHLRELEGGKE
RLILCKADLQDYEALKAAIDGCDGVFHTASPVTDDPEQMVEPAVNGAKFVINAAAEAKVK
RVVITSSIGAVYMDPNRDPEAVVDESCWSDLDFCKNTKNWYCYGKMVAEQAAWETAKEKG
VDLVVLNPVLVLGPPLQPTINASLYHVLKYLTGSAKTYANLTQAYVDVRDVALAHVLVYE
APSASGRYLLAESARHRGEVVEILAKLFPEYPLPTKCKDEKNPRAKPYKFTNQKIKDLGL
EFTSTKQSLYDTVKSLQEKGHLAPPPPPPSASQESVENGIKIGS

MLVDGKLVCVTGAGGYIASWIVKLLLERGYTVRGTVRNPTDPKNNHLRELQGAKERLTLH
SADLLDYEALCATIDGCDGVFHTASPMTDDPETMLEPAVNGAKFVIDAAAKAKVKRVVFT
SSIGAVYMNPNRDTQAIVDENCWSDLDFCKNTKNWYCYGKMLAEQSAWETAKAKGVDLVV
LNPVLVLGPPLQSAINASLVHILKYLTGSAKTYANLTQVYVDVRDVALGHVLVYEAPSAS
GRYILAETALHRGEVVEILAKFFPEYPLPTKCSDEKNPRAKPYKFTTQKIKDLGLEFKPI
KQSLYESVKSLQEKGHLPLPQDSNQNEVIIES

www.000webhost.com

Other information
Ka divergence:0.32306KaKs divergence:0.319171
GC content 1 (%):51GC content 2 (%):50GC content divergence:-0.01
Length 1 (bp):1035Length 2 (bp):999Length divergence:-0.018
MFE 1 (kcal):-344.25MFE 2 (kcal):-331MFE divergence-0.02