Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G15960-AT1G80830
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):NRAMP metal ion transporter 6
Function (paralog2):natural resistance-associated macrophage protein 1

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:2.7518315177211
Log2 mRNA fold difference:3.1583485203174
Log2 TE fold difference:-0.3867460117045
Sequences
Protein sequence

MAAETASGSNRSISNSPLIENSDSNQILVPEKKSWKNFFSYLGPGFLVSIAYIDPGNFET
DLQSGAQYKYELLWIILVASCAALVIQSLAANLGVVTGKHLAEHCRAEYSKVPNFMLWVV
AEIAVVACDIPEVIGTAFALNMLFNIPVWIGVLLTGLSTLILLALQQYGIRKLEFLIAFL
VFTIALCFFVELHYSKPDPKEVLYGLFVPQLKGNGATGLAISLLGAMVMPHNLFLHSALV
LSRKIPRSVTGIKEACRYYLIESGLALMVAFLINVSVISVSGAVCNASDLSPEDRASCQD
LDLNKASFLLRNVVGKWSSKLFAIALLASGQSSTITGTYAGQYVMQGFLDLRLEPWLRNF
LTRCLAIIPSLIVALIGGSAGAGKLIIIASMILSFELPFALVPLLKFTSSKTKMGSHANS
LVISSVTWIIGGLIMGINIYYLVSSFIKLLLHSHMNLVAIVFLGVLGFSGIATYLAAISY
LVLRKNRESSSTHFLDFSNSQTEETLPREDIANMQLPNRVAVIGDLN

MAATGSGRSQFISSSGGNRSFSNSPLIENSDSNQIIVSEKKSWKNFFAYLGPGFLVSIAY
IDPGNFETDLQAGAHYKYELLWIILVASCAALVIQSLAANLGVVTGKHLAEQCRAEYSKV
PNFMLWVVAEIAVVACDIPEVIGTAFALNMLFSIPVWIGVLLTGLSTLILLALQKYGVRK
LEFLIAFLVFTIAICFFVELHYSKPDPGEVLHGLFVPQLKGNGATGLAISLLGAMVMPHN
LFLHSALVLSRKIPRSASGIKEACRFYLIESGLALMVAFLINVSVISVSGAVCNAPNLSP
EDRANCEDLDLNKASFLLRNVVGKWSSKLFAIALLASGQSSTITGTYAGQYVMQGFLDLR
LEPWLRNLLTRCLAIIPSLIVALIGGSAGAGKLIIIASMILSFELPFALVPLLKFTSCKT
KMGSHVNPMAITALTWVIGGLIMGINIYYLVSSFIKLLIHSHMKLILVVFCGILGFAGIA
LYLAAIAYLVFRKNRVATSLLISRDSQNVETLPRQDIVNMQLPCRVSTSDVD

Other information
Ka divergence:-0.0468441KaKs divergence:0.975682
GC content 1 (%):41GC content 2 (%):44GC content divergence:0.035
Length 1 (bp):1584Length 2 (bp):1599Length divergence:0.005
MFE 1 (kcal):-454.89MFE 2 (kcal):-499.39MFE divergence0.047