Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G16000-AT1G80890
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.7848298310036
Log2 mRNA fold difference:-1.151176298626
Log2 TE fold difference:-0.72438509157597
Sequences
Protein sequence

MGNETKTNGGPASMAGGGGFRAKMEHYVYSGEKKHVLVGIGIVTIIFGVPWYLMTQGSKH
QSHQDYMDKADKARKARLSSSSSANK

MGNESKSNLGGGGIRAKMEHYVYSGEKKHVLAGIGIISIIFGIPWYLMNQGSKHRSHQDY
LEKADKARKARLSSSSSSDK

www.000webhost.com

Other information
Ka divergence:-0.366811KaKs divergence:0.264473
GC content 1 (%):47GC content 2 (%):44GC content divergence:-0.033
Length 1 (bp):261Length 2 (bp):243Length divergence:-0.036
MFE 1 (kcal):-72.5MFE 2 (kcal):-65.2MFE divergence-0.053