Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G16010-AT1G80900
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):magnesium transporter 2
Function (paralog2):magnesium transporter 1

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-2.2655058126876
Log2 mRNA fold difference:-2.2304587741142
Log2 TE fold difference:0.11460444369381
Sequences
Protein sequence

MSELKERLLPPRPASAMNLRDASVTRPSASGRPPLLGVDVLGLKKRGQGLRSWIRVDTSG
NTQVMEVDKFTMMRRCDLPARDLRLLDPLFVYPSTILGREKAIVVNLEQIRCIITADEVL
LLNSLDNYVLRYVVELQQRLKTSSVGEMWQQENSQLSRRRSRSFDNAFENSSPDYLPFEF
RALEIALEAACTFLDSQASELEIEAYPLLDELTSKISTLNLERVRRLKSRLVALTRRVQK
VRDEIEQLMDDDGDMAEMYLTEKKRRMEGSMYGDQSLLGYRSNDGLSVSAPVSPVSSPPD
SRRLDKSLSIARSRHDSARSSEGAENIEELEMLLEAYFVVIDSTLNKLTSLKEYIDDTED
FINIQLDNVRNQLIQFELLLTTATFVVAIFGVVAGIFGMNFEIDFFNQPGAFRWVLIITG
VCGFVIFSAFVWFFKYRRLMPL

MSELKERLLPPRPASAINLRGDAGSRPSPSGRQPLLGVDVLGLKKRGQGLKSWIRVDTSA
NSQVIEVDKFTMMRRCDLPARDLRLLDPLFVYPSTILGREKAIVVNLEQIRCIITADEVL
LLNSLDNYVLRYVVELQQRLKASSVTEVWNQDSLELSRRRSRSLDNVLQNSSPDYLPFEF
RALEVALEAACTFLDSQASELEIEAYPLLDELTSKISTLNLERARRLKSRLVALTRRVQK
VRDEIEQLMDDDGDMAEMYLTEKKKRMEGSLYGDQSLPVYRTNDCFSLSAPVSPVSSPPE
SRRLEKSLSIVRSRHDSARSSEDATENIEELEMLLEAYFVVIDSTLNKLTSLKEYIDDTE
DFINIQLDNVRNQLIQFELLLTTATFVVAIFGVVAGIFGMNFEIDFFEKPGAFKWVLAIT
GVCGLVVFLAFLWYYKRRRLMPL

Other information
Ka divergence:0.413644KaKs divergence:0.220605
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):1329Length 2 (bp):1332Length divergence:0.001
MFE 1 (kcal):-413.2MFE 2 (kcal):-416.85MFE divergence0.004