Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G16020-AT1G80910
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein of unknown function (DUF1712)
Function (paralog2):Protein of unknown function (DUF1712)

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.84814682082517
Log2 mRNA fold difference:0.12506094553156
Log2 TE fold difference:0.73595310339447
Sequences
Protein sequence

MASMSSGDESLRLCMFDLRRGQTEGQELEKILFFYPADLDFSTQLSVIGLSEGLITFTRL
FSPEAACEVIEAERHSHVFYEAEPDIWMVMVVEKNKETGAIWRIDALRRVLKEVHSLFVM
FHGSIRALIEKEPTGGLTRSLLYPFITDYLSTFQIWSLSEDCCCEFFVGKKLQLPTFRET
LRERGTVQMLTLARDTAVEVQSLVQVLDSCAGSLRCHSMILFQDLLVSTTLSADDTVDLF
TFAVMRLTSKALSSDTSSWSYLRKGPGSSEISSRSNLAPVGSIDSLHSRNGNNMHHVIRP
LQNDKWTKGKDGFLITDIWGLETGGSPDSAIPTIWLQQTQERMYLLAYQHKSLTLLLLMP
TNAIVNGDLSISAVKQQVIEDASLRILKIEENISRGWGGENAYHIKGYRYLVVDNDTKVS
RSSPSGKVTTLAKESLLALNKLREEVDSEKSRAKGQEKDMEICIRAKNNVWVIARVTRGK
ELYMALEKGSDTLLDTTDAVGRFSNRYCSGAFLMD

MGMASMSSGTESLRLCVFDLRRGQHEGQELDKILFFYPPDLTFSTQLSVIGLSEGLITFT
RLFSPEAACEVIEAERHSHVFYEAEPDIWMVMIVEKNKEIEAVWRIDALRRVLKEVHSLF
VMFQGSIRALLEKEPTGGLVRSHLYPFITDYLNDLFVGKKQQLPSFRDTLKERGTVQMLT
LARDAALEVQSLVGVLDSCAGTVRCHSVILFHDLLVSTTLSPDDTVDLFAFSVMRLTTNA
LSSGTSSWSYLRKGSGSPQISSRSTTVPPLGSGGTLPSGNGSSTGRVIRPLQHDKWSKGK
DGFLVTDIWGLDATPTILIQKTQESFYLLTYQYKSLTLVLLVPIAAIVNGELDISFVKQQ
VIENASTKILKVEEKLSKGWGGENAYHVSGYRYLLVDNDMEVSRASPPGKVATLAKESLL
ALNKLREEVDTEKNRSKQEKDMEICIRAKNNTWVIARLNRGKELYMALEKASETLLDATD
SVQRFSNRYCSGAFPMD

www.000webhost.com

Other information
Ka divergence:-0.0640533KaKs divergence:0.131235
GC content 1 (%):42GC content 2 (%):44GC content divergence:0.023
Length 1 (bp):1548Length 2 (bp):1494Length divergence:-0.018
MFE 1 (kcal):-446.56MFE 2 (kcal):-456.98MFE divergence0.012