Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G16060-AT1G79700
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):ARIA-interacting double AP2 domain protein
Function (paralog2):Integrase-type DNA-binding superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:1.6825190598975
Log2 mRNA fold difference:2.1536294925212
Log2 TE fold difference:-0.44622622692671
Sequences
Protein sequence

MFIAVEVSPVMEDITRQSKKTSVENETGDDQSATSVVLKAKRKRRSQPRDAPPQRSSVHR
GVTRHRWTGRYEAHLWDKNSWNETQTKKGRQVYLGAYDEEDAAARAYDLAALKYWGRDTI
LNFPLCNYEEDIKEMESQSKEEYIGSLRRKSSGFSRGVSKYRGVAKHHHNGRWEARIGRV
FGNKYLYLGTYATQEEAAIAYDIAAIEYRGLNAVTNFDISRYLKLPVPENPIDTANNLLE
SPHSDLSPFIKPNHESDLSQSQSSSEDNDDRKTKLLKSSPLVAEEVIGPSTPPEIAPPRR
SFPEDIQTYFGCQNSGKLTAEEDDVIFGDLDSFLTPDFYSELNDC

MAKVSGRSKKTIVDDEISDKTASASESASIALTSKRKRKSPPRNAPLQRSSPYRGVTRHR
WTGRYEAHLWDKNSWNDTQTKKGRQVYLGAYDEEEAAARAYDLAALKYWGRDTLLNFPLP
SYDEDVKEMEGQSKEEYIGSLRRKSSGFSRGVSKYRGVARHHHNGRWEARIGRVFGNKYL
YLGTYATQEEAAIAYDIAAIEYRGLNAVTNFDVSRYLNPNAAADKADSDSKPIRSPSREP
ESSDDNKSPKSEEVIEPSTSPEVIPTRRSFPDDIQTYFGCQDSGKLATEEDVIFDCFNSY
INPGFYNEFDYGP

www.000webhost.com

Other information
Ka divergence:0.127938KaKs divergence:-0.577087
GC content 1 (%):46GC content 2 (%):47GC content divergence:0.011
Length 1 (bp):1038Length 2 (bp):942Length divergence:-0.048
MFE 1 (kcal):-291.32MFE 2 (kcal):-264.7MFE divergence-0.048