Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G16090-AT1G79670
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):wall associated kinase-like 7
Function (paralog2):Wall-associated kinase family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:2.7691216516284
Log2 mRNA fold difference:4.3495573910226
Log2 TE fold difference:-1.2727427246422
Sequences
Protein sequence

MSREKFSIYNLLSLLVLLIHGLIAASAQDLTVFSSCQSHCGGIAIPYPFGIGKDCYLNNN
EWYEVICNRTSGNPLPVLKSINRELVNISLPDDSSDVFGLTRIKNPVTSLGCSNMEEISL
ALNVTGSPFFLTGRNTLVAVGCNNNASMTDDKLQIGGCESTCDVGFGQRGRNRSCNGYRC
CQAKILSDRLQQIGIKIESLDDEAYSPLNITEPALFYDKGYGTVELGWFIDRLHNMSVVL
GFAIQLPRVQAVGVTSEAIEAAGVTVATEAIHISRVDVQILMSVKKPKLKEATIVGKGMI
VRISQETLGVNPTKTKD

MKRRRLFFSVLLSILTLFINGPLITTAQSPPSSSTSCNRICGGIEIPFPFGIGRRDCFLN
DWYEVVCNSTTSGKSLAPFLYKINRELVSITLRSSIDSSYGVVHIKSPVTSSGCSQRPVK
PLPLNLTGKGSPFFITDSNRLVSVGCDNRALITDIESQITGCESSCDGDKSRLDKICGGY
TCCQAKIPADRPQVIGVDLESSGGNTTQGGNCKVAFLTNETYSPANVTEPEQFYTNGFTV
IELGWYFDTSDSRLTNPVGCVNLTETGIYTSAPSCVCEYGNFSGFGYSNCYCNQIGYRGN
PYLPGGCIDIDECEEGKGLSSCGELTCVNVPGSWRCELNGVGKIKPLFPGLVLGFPLLFL
VLGIWGLIKFVKKRRKIIRKRMFFKRNGGLLLKQQLTTRGGNVQSSKIFSSKELEKATDN
FNMNRVLGQGGQGTVYKGMLVDGRIVAVKRSKVLDEDKVEEFINEVGVLSQINHRNIVKL
MGCCLETEVPILVYEHIPNGDLFKRLHHDSDDYTMTWDVRLRISVEIAGALAYLHSAAST
PVYHRDVKTTNILLDEKYRAKVSDFGTSRSINVDQTHLTTLVAGTFGYLDPEYFQTSQFT
DKSDVYSFGVVLVELITGEKPFSVMRPEENRGLVSHFNEAMKQNRVLDIVDSRIKEGCTL
EQVLAVAKLARRCLSLKGKKRPNMREVSVELERIRSSPEDLELHIEEEDEEECAMEINMD
DSWSVDMTAPASLFDLSPKLDVEPLVPQRTW

Other information
Ka divergence:-0.451615KaKs divergence:-0.17218
GC content 1 (%):44GC content 2 (%):43GC content divergence:-0.011
Length 1 (bp):954Length 2 (bp):2256Length divergence:0.406
MFE 1 (kcal):-287.52MFE 2 (kcal):-722.03MFE divergence0.43