Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G16170-AT1G79660
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.64589002489231
Log2 mRNA fold difference:-1.0631839249663
Log2 TE fold difference:0.34961261676798
Sequences
Protein sequence

MVLDGLVSSPSRRQQCLKKQWDELGSWSTLIQRHQYLLTALALLAFLCTVYLYFAVTLGA
RHSSCYGLTGKDKAMCQLQLVQALSKGKLKFF

MVLDGIVSSPLRRPHALKKQWDDLGSCSTVVQRHRFLLTAMLLLAFLCTIYIYFAVTLGA
RHLLCSGMTGKDKAMCQMEHIQASFSNGKLKFF

Other information
Ka divergence:0.121755KaKs divergence:0.229529
GC content 1 (%):44GC content 2 (%):45GC content divergence:0.011
Length 1 (bp):279Length 2 (bp):282Length divergence:0.005
MFE 1 (kcal):-77.1MFE 2 (kcal):-82.4MFE divergence0.033