Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G16190-AT1G79650
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Rad23 UV excision repair protein family
Function (paralog2):Rad23 UV excision repair protein family

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:0.21225275527894
Log2 mRNA fold difference:0.11685664763532
Log2 TE fold difference:0.12839248764552
Sequences
Protein sequence

MKLTVKTLKGSHFEIRVLPTDTIMAVKKNIEDSQSKDNYPCGQQLLIHNGKVLKDETTLV
ENKVTEEGFLVVMLSKSKTASSAGPSSTQPTSTTTSTISSTTLAAPSTTQSIAVPASNST
PVQEQPTAQSDTYGQAASTLVSGSSIEQMVQQIMEMGGGSWDKETVTRALRAAYNNPERA
VDYLYSGIPETVTIPATNLSGVGSGRELTAPPPSGGPNSSPLDLFPQEAVSDAAGGDLGT
LEFLRGNDQFQQLRSMVNSNPQILQPMLQELGKQNPQLLRLIQENQAEFLQLLNEPYEGS
DGDVDIFDQPDQEMPHSVNVTPEEQESIERLEAMGFDRAIVIEAFLSCDRNEELAANYLL
EHSADFED

MKLTVKTLKGSHFEIRVLPSDTIMAVKKNIEDSQGKDNYPCGQQLLIHNGKVLKDETSLV
ENKVTEEGFLVVMLSKSKSGGSAGQASVQTSSVSQPVSATTSSTKPAAPSTTQSSPVPAS
PIPAQEQPAVYAFVFSFAGLAFCPLYGFPKVSMAQTDTYGQAASTLVSGSSLEQMVQQIM
EMGGGSWDKETVTRALRAAYNNPERAVDYLYSGIPQTAEVAVPVPEAQIAGSGAAPVAPA
SGGPNSSPLDLFPQETVAAAGSGDLGTLEFLRNNDQFQQLRTMVHSNPQILQPMLQELGK
QNPQLLRLIQENQAEFLQLVNEPYEGSDGEGDMFDQPEQEMPHAINVTPAEQEAIQRLEA
MGFDRALVIEAFLACDRNEELAANYLLENSGDFED

www.000webhost.com

Other information
Ka divergence:0.0268891KaKs divergence:-0.0478024
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):1107Length 2 (bp):1188Length divergence:0.035
MFE 1 (kcal):-325.06MFE 2 (kcal):-358.44MFE divergence0.049