Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G16220-AT1G79630
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein phosphatase 2C family protein
Function (paralog2):Protein phosphatase 2C family protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-1.9106634061378
Log2 mRNA fold difference:0.95534677779334
Log2 TE fold difference:-2.8312989653971
Sequences
Protein sequence

MGLCHSKIDKTTRKETGATSTATTTVERQSSGRLRRPRDLYSGGEISEIQQVVGRLVGNG
SSEIACLYTQQGKKGTNQDAMLVWENFCSRSDTVLCGVFDGHGPFGHMVSKRVRDMLPFT
LSTQLKTTSGTEQSSSKNGLNSAPTCVDEEQWCELQLCEKDEKLFPEMYLPLKRALLKTC
QQMDKELKMHPTINCFCSGTTSVTVIKQGKDLVVGNIGDSRAVLATRDQDNALVAVQLTI
DLKPDLPSESARIHRCKGRVFALQDEPEVARVWLPNSDSPGLAMARAFGDFCLKDYGLIS
VPDINYHRLTERDQYIILATDGVWDVLSNKEAVDIVASAPSRDTAARAVVDTAVRAWRLK
YPTSKNDDCAVVCLFLEDTSAGGTVEVSETVNHSHEESTESVTITSSKDADKKEEASTET
NETVPVWEIKEEKTPESCRIESKKTTLAECISVKDDEEWSALEGLTRVNSLLSIPRFFSG
ELRSSSWRKWL

MGLCYSVDRTTGKEPGEASSTATTAETVEERSGSGRWRRPRDLKGGGDIEGIPQVLGRLV
SNGSSKIACLYTQQGKKGTNQDAMLVFENFCSRDDTVFCGVFDGHGPFGHMVAKKVRDTL
PFTLLTQLKMTSESDQSSLVGANGFQIKCTEEEEVQTTESEQVQKTESVTTMDEQWCELN
PNVNNDELPEMYLPLKHAMLKSCQQIDKELKMHPTIDCFCSGTTSVTLIKQGEDLVVGNI
GDSRAVLATRDEDNALLAVQLTIDLKPDLPGESARIQKCKGRVFALQDEPEVARVWLPNS
DSPGLAMARAFGDFCLKDYGLISVPDINYRRLTERDQFIILASDGVWDVLSNKEAVDIVA
SAPSRSTAARALVDTAVRSWRIKYPTSKNDDCTVVCLFLQDSSVAMEVSTNVKKDSPKEE
SIESVTNSTSKEEDEIVPVKDEKIPESCGIESKMMTMTLAECISVAQDDEEWSALEGLTR
VNSLLSIPRFLSGELRSTSWRKWL

www.000webhost.com

Other information
Ka divergence:-0.0519797KaKs divergence:0.521899
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):1476Length 2 (bp):1515Length divergence:0.013
MFE 1 (kcal):-446.5MFE 2 (kcal):-456.32MFE divergence0.011