Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G16230-AT1G79590
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Target SNARE coiled-coil domain protein
Function (paralog2):syntaxin of plants 52

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:2.938127648862
Log2 mRNA fold difference:3.811003010126
Log2 TE fold difference:-0.95815297692181
Sequences
Protein sequence

MASLCDSWIREQNETLKLSEEIDGMILERSSLAETSSYALRHASSMRRKITILATRVQTL
KYLLAESQGKSISGKEMSRRKGTFENLRSKANQMASALDMLKFSNIDILLRPEKDDIMSR
VIGLDNQGIVGLHRQVMKEHDEALDMLEETVMRVKHNALVMNEQIGLQTRLIDGLDHHVD
VSDSGVRVIHIRA

MASSSDPWMREYNEALKLSEDINGMMSERNASGLTGPDAQRRASAIRRKITILGTRLDSL
QSLLVKVPGKQHVSEKEMNRRKDMVGNLRSKTNQVASALNMSNFANRDSLFGTDLKPDDA
INRVSGMDNQGIVVFQRQVMREQDEGLEKLEETVMSTKHIALAVNEELTLQTRLIDDLDY
DVDITDSRLRRVQKSLALMNKSMKSGCSCMSMLLSVLGIVGLALVIWLLVKYL

www.000webhost.com

Other information
Ka divergence:-0.480881KaKs divergence:-0.425247
GC content 1 (%):40GC content 2 (%):44GC content divergence:0.048
Length 1 (bp):582Length 2 (bp):702Length divergence:0.093
MFE 1 (kcal):-157MFE 2 (kcal):-217.77MFE divergence0.162