Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G16260-AT1G79670
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Wall-associated kinase family protein
Function (paralog2):Wall-associated kinase family protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-1.4165563894651
Log2 mRNA fold difference:-0.21991937511635
Log2 TE fold difference:-1.2144217405591
Sequences
Protein sequence

MGVDVKRFLVVMLLLRICEYAAASTFPLALRNCSDHCGNVSVPYPFGIGKGCYKNKWFEI
VCKSSSDQQPILLLPRIRRAVTSFNLGDPFSISVYNKFYIQSPLKHSGCPNRDGYSSSSL
NLKGSPFFISENNKFTAVGCNNKAFMNVTGLQIVGCETTCGNEIRSYKGANTSCVGYKCC
QMTIPPLLQLQVFDATVEKLEPNKQGCQVAFLTQFTLSGSLFTPPELMEYSEYTTIELEW
RLDLSYMTSKRVLCKGNTFFEDSYQCSCHNGYEGNPYIPGGCQDIDECRDPHLNKCGKRK
CVNVLGSYRCEKTWPAILSGTLSSGLLLLIFGMWLLCKANRKRKVAKQKRKFFQRNGGLL
LQQQTSFLHGSVNRTKVFSSNDLENATDRFNASRILGQGGQGTVYKGMLEDGMIVAVKKS
KALKEENLEEFINEIILLSQINHRNVVKILGCCLETEVPILVYEFIPNRNLFDHLHNPSE
DFPMSWEVRLCIACEVADALSYLHSAVSIPIYHRDVKSTNILLDEKHRAKVSDFGISRSV
AIDDTHLTTIVQGTIGYVDPEYLQSNHFTGKSDVYSFGVLLIELLTGEKPVSLLRRQEVR
MLGAYFLEAMRNDRLHEILDARIKEECDREEVLAVAKLARRCLSLNSEHRPTMRDVFIEL
DRMQSKRKGTQSQAQNGEEHAHIQIAMPESMSLSYSSPNIVVENSSFSLDTKPLMPHKTQ

MKRRRLFFSVLLSILTLFINGPLITTAQSPPSSSTSCNRICGGIEIPFPFGIGRRDCFLN
DWYEVVCNSTTSGKSLAPFLYKINRELVSITLRSSIDSSYGVVHIKSPVTSSGCSQRPVK
PLPLNLTGKGSPFFITDSNRLVSVGCDNRALITDIESQITGCESSCDGDKSRLDKICGGY
TCCQAKIPADRPQVIGVDLESSGGNTTQGGNCKVAFLTNETYSPANVTEPEQFYTNGFTV
IELGWYFDTSDSRLTNPVGCVNLTETGIYTSAPSCVCEYGNFSGFGYSNCYCNQIGYRGN
PYLPGGCIDIDECEEGKGLSSCGELTCVNVPGSWRCELNGVGKIKPLFPGLVLGFPLLFL
VLGIWGLIKFVKKRRKIIRKRMFFKRNGGLLLKQQLTTRGGNVQSSKIFSSKELEKATDN
FNMNRVLGQGGQGTVYKGMLVDGRIVAVKRSKVLDEDKVEEFINEVGVLSQINHRNIVKL
MGCCLETEVPILVYEHIPNGDLFKRLHHDSDDYTMTWDVRLRISVEIAGALAYLHSAAST
PVYHRDVKTTNILLDEKYRAKVSDFGTSRSINVDQTHLTTLVAGTFGYLDPEYFQTSQFT
DKSDVYSFGVVLVELITGEKPFSVMRPEENRGLVSHFNEAMKQNRVLDIVDSRIKEGCTL
EQVLAVAKLARRCLSLKGKKRPNMREVSVELERIRSSPEDLELHIEEEDEEECAMEINMD
DSWSVDMTAPASLFDLSPKLDVEPLVPQRTW

www.000webhost.com

Other information
Ka divergence:-0.0906081KaKs divergence:-0.614712
GC content 1 (%):42GC content 2 (%):43GC content divergence:0.012
Length 1 (bp):2163Length 2 (bp):2256Length divergence:0.021
MFE 1 (kcal):-620.67MFE 2 (kcal):-722.03MFE divergence0.075