Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G16300-AT1G79530
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):glyceraldehyde-3-phosphate dehydrogenase of plastid 2
Function (paralog2):glyceraldehyde-3-phosphate dehydrogenase of plastid 1

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:3.4636452156529
Log2 mRNA fold difference:2.6160779690078
Log2 TE fold difference:0.84494617461094
Sequences
Protein sequence

MALSSLLRSAATSAAAPRVELYPSSSYNHSQVTSSLGFSHSLTSSRFSGAAVSTGKYNAK
RVQPIKATATEAPPAVHRSRSSGKTKVGINGFGRIGRLVLRIATFRDDIEVVAVNDPFID
AKYMAYMFKYDSTHGNYKGTINVIDDSTLEINGKQVKVVSKRDPAEIPWADLGAEYVVES
SGVFTTVGQASSHLKGGAKKVIISAPSADAPMFVVGVNEKTYLPNMDIVSNASCTTNCLA
PLAKVVHEEFGILEGLMTTVHATTATQKTVDGPSMKDWRGGRGASQNIIPSSTGAAKAVG
KVLPELNGKLTGMAFRVPTPNVSVVDLTCRLEKDASYEDVKAAIKFASEGPLRGILGYTE
EDVVSNDFLGDSRSSIFDANAGIGLSKSFMKLVSWYDNEWGYSNRVLDLIEHMALVAASR

MAFSSLLRSAASYTVAAPRPDFFSSPASDHSKVLSSLGFSRNLKPSRFSSGISSSLQNGN
ARSVQPIKATATEVPSAVRRSSSSGKTKVGINGFGRIGRLVLRIATSRDDIEVVAVNDPF
IDAKYMAYMLKYDSTHGNFKGSINVIDDSTLEINGKKVNVVSKRDPSEIPWADLGADYVV
ESSGVFTTLSKAASHLKGGAKKVIISAPSADAPMFVVGVNEHTYQPNMDIVSNASCTTNC
LAPLAKVVHEEFGILEGLMTTVHATTATQKTVDGPSMKDWRGGRGASQNIIPSSTGAAKA
VGKVLPELNGKLTGMAFRVPTSNVSVVDLTCRLEKGASYEDVKAAIKHASEGPLKGILGY
TDEDVVSNDFVGDSRSSIFDANAGIGLSKSFVKLVSWYDNEWGYSNRVLDLIEHMALVAA
SH

Other information
Ka divergence:0.0945732KaKs divergence:-0.251839
GC content 1 (%):46GC content 2 (%):46GC content divergence:0
Length 1 (bp):1263Length 2 (bp):1269Length divergence:0.002
MFE 1 (kcal):-395.46MFE 2 (kcal):-401.79MFE divergence0.008