Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G16310-AT1G79520
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Cation efflux family protein
Function (paralog2):Cation efflux family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.042782793979355
Log2 mRNA fold difference:1.2509199407517
Log2 TE fold difference:-1.2163484665701
Sequences
Protein sequence

MPLNSYIFFLFLTTSPRNTFFGIRTHSDRIMATEHITRTGDEYNVELLPSDDDAPPLESS
WRLNLDAFQLPSSTGGRHDGRTRFSRYFRTPRKERRVSEYYKKQERLLEGFNEMETIHEN
GFASGVPTEEEMKKLAKSERLAVHISNATNLVLFVAKVYASMESRSMAVIASTLDSLLDL
LSGFILWFTANAMRKPNQFHYPIGKRRMQPVGIIVFASVMATLGLQVLLESGRQLVAKSG
IHMNSTEEKWMIGIMVSVTIVKFLLMLYCRGFQNEIVRAYAQDHLFDVVTNSIGLATAVL
AVKFYWWIDPTGAILIALYTIATWARTVLENVHSLIGRSAPPDFLAKLTFLIWNHHEQIK
HIDTVRAYTFGSHYFVEVDIVLPEDMRLQEAHNIGETLQEKLEQLAEVERAFVHIDFEFT
HRPEHKCN

MAATEHRGLSGGDYNVDLLPIDQDDSPPSSWRLSLDTFRLPSSSPLSSGRHNGRTRLSRY
LRTPSKFLFLVLVLNLQKERKVSEYYKQQEKLLEGFNEMETINETGFVSGAPTEEELKKL
AKSERLAVHISNAANLVLFVAKVYASVESRSMAVIASTLDSLLDLLSGFILWFTANAMRT
PNNFRYPIGKRRMQPVGIIVFASVMATLGLQVILESTRLLVSKNGSHMSSTEEKWMIGIM
ASATVVKFLLMLYCRSFQNEIVRAYAQDHLFDVITNSVGLATAVLAVKFYWWIDPSGAIL
IALYTISTWARTVLENVHSLIGRSAPPDFLAKLTFLIWNHHEKIKHIDTVRAYTFGSHYF
VEVDIVLPEDMRLHEAHNIGETLQEKLEQLSEVERAFVHIDFEFTHRPEHKCKV

Other information
Ka divergence:-0.0297885KaKs divergence:-0.271341
GC content 1 (%):45GC content 2 (%):44GC content divergence:-0.011
Length 1 (bp):1287Length 2 (bp):1245Length divergence:-0.017
MFE 1 (kcal):-388.24MFE 2 (kcal):-383.86MFE divergence-0.006