Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G16320-AT1G79510
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Uncharacterized conserved protein (DUF2358)
Function (paralog2):Uncharacterized conserved protein (DUF2358)

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.19102799942397
Log2 mRNA fold difference:-0.99915826927807
Log2 TE fold difference:1.225529930862
Sequences
Protein sequence

MAFLLSNLSSPSIHLQTGKYPNLKPIFSQSLSSSSSVSYEFVEENLSTLSLLSIQSPPLK
DTQVQTRHSSQDKHNNHDRDEFYINLGVAVRTLREDLPLLFTRDLNYDIYRDDITFVDPM
NTFTGMDNYKIIFWALRFHGKILFRDISLEIFRVWQPSENMILIRWNLKGVPRVPWEAKG
EFQGTSRYKLDRNGKIYEHKVDNLAFNFPQQLKPAASVLDLVTASPASSPNPTFFFSPVD
SYSSSWVKFYQAVRGTLETEDMFVTTDCLVTCS

MAFLLPNLSPSFLLPTGKSLKEKPISNQALSSSSSSSNSYEFEEDSLSPLSLFSVQAPPP
VRGAQVKTKPSAQDKYQHGSKDDFYINLGLAVRTLREDLPLLFTKDLNYDIYRDDITLVD
PMNTFSGIDNYKLIFWALRFHGKILFRDISLEIFRVWQPSENMILIRWNLKGVPRVPWEA
KGEFQGTSRYKLDRNGKIYEHKVDNLAFNFPHQLKPATSVLDMVTACPASPNPTFMFGAM
DSYSSSWIEFYKAVQRTLDKQEEQMLVQDHFVPCS

www.000webhost.com

Other information
Ka divergence:-0.180932KaKs divergence:-0.221651
GC content 1 (%):41GC content 2 (%):45GC content divergence:0.047
Length 1 (bp):822Length 2 (bp):828Length divergence:0.004
MFE 1 (kcal):-207.56MFE 2 (kcal):-217.76MFE divergence0.024