Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G16340-AT1G79500
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Aldolase superfamily protein
Function (paralog2):Aldolase-type TIM barrel family protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:0.9651745352976
Log2 mRNA fold difference:-0.072095506523283
Log2 TE fold difference:1.0555922343872
Sequences
Protein sequence

MANSASLLYDQLKVAEPFFLLAGPNVIESEEHVLRMAKSIKDISTKYVLGLPLVFKSSFD
KANRTSSKSFRGPGMAEGLKILEKVKVAFDLPIVTDVHESSQCEAVGKVADIIQIPAFLC
RQTDLLVAAAQSGKIINIKKGQFCGHSVMRNSAEKVRLAGNPNVMVCERGTMFGYNDLIV
DPRNLEWMREADCPVVADITHSLQQPAGKKLDGGGVASGGLRELIPCIARTAVAVGVDGI
FMEVHDDPLNAPVDGPTQWPLRHLEELLEELIAIASVTKGKQQFQIDLTPYRD

MAKHIKDISTKVGLPLVFKSSFDKANRTSSKSFRGPGMAEGLKILEKVKVAYDLPIVTDV
HESSQCEAVGKVADIIQIPAFLCRQTDLLVAAAQTGKIINIKKGQFCAPSVMENSAEKIR
LAGNPNVMVCERGTMFGYNDLIVDPRNFEWMREANCPVVADITHSLQQPAGKKLDGGGVA
SGGLRELIPCIARTAVAVGVDGIFMEVHDDPLSAPVDGPTQWPLRHLEELLEELIAIAIL
TLLFRRGLQKGSSGFKSTLHPTVIKIKGSVIASFHKFASTIPLSRFSLSRKRNRAEKADV
RKKMSFEKAQNPALGFNLETWNFYQLANSRERSQND

www.000webhost.com

Other information
Ka divergence:0.103851KaKs divergence:0.241332
GC content 1 (%):44GC content 2 (%):43GC content divergence:-0.011
Length 1 (bp):882Length 2 (bp):1011Length divergence:0.068
MFE 1 (kcal):-256.1MFE 2 (kcal):-298.32MFE divergence0.076