Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G16350-AT1G79470
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Aldolase-type TIM barrel family protein
Function (paralog2):Aldolase-type TIM barrel family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-2.7376561781477
Log2 mRNA fold difference:-2.3119911329643
Log2 TE fold difference:-0.35803348540768
Sequences
Protein sequence

MSGFEDGFSAEKLFSQGYSYTYDDVIFLPHFIDFSTDAVSLSTRLSKRVPLSIPCVASPM
DTVSESHMAAAMAALGGIGIVHYNCDIDTQASVIRHAKSLQVPIASDAVFKCPEHQIGSV
DDFGPSSFVFVSQTGTLTPKLLGYVSKSEWSSMKDDQKEVKIYDYMKSCENKDYYVPWDI
DLDKIEAVLEDKQKGFVVLEKEGETVNVVTKDDVERVKGYPKLGSGTVGADKKWMVGAAI
GTRESDKERLEHLVKAGANVVVLDSSQGNSIYQLEMIKYVKNTYPELDVVGGNVVTMYQA
ENLIKAGVDGLRVGMGSGSICTTQEVCAVGRGQATAVYKVSTLAAQHGVPVIADGGISNS
GHIVKALVLGASTVMMGSFLAGSTEAPGAYEYRNGRRVKKYRGMGSLEAMTKGSDQRYLG
DTAKLKIAQGVVGAVADKGSVLKFIPYTMHAVKQGFQDLGASSLQSAHELLRDNTLRLEA
RTGAAQIEGGIHGLVSYEKKSF

MSTLEDGFPADKLFAQGYSYTYDDVIFLPHFIDFSTDAVSLSTRLSRRVPLSIPCVSSPM
DTVSESHMAAAMASLGGIGIVHYNCGIAAQASIIRQAKSLKHPIASDAGVKFPEYEITSL
DAFGPSSFVFVEQTGTMTTPKLLGYVTKSQWKRMNYEQREMKIYDYMKSCDSSDYCVPWE
IDFEKLEFVLEDKQKGFVVLERDGETVNVVTKDDIQRVKGYPKSGPGTVGPDGEWMVGAA
IGTRESDKERLEHLVNVGVNAVVLDSSQGNSIYQLEMIKYVKKTYPELDVIGGNVVTMYQ
AQNLIQAGVDGLRVGMGSGSICTTQEVCAVGRGQATAVYKVCSIAAQSGIPVIADGGISN
SGHIVKALVLGASTVMMGSFLAGSTEAPGGYEYTNGKRIKKYRGMGSLEAMTKGSDQRYL
GDQTKLKIAQGVVGAVADKGSVLKLIPYTMHAVKQGFQDLGASSLQSAHGLLRSNILRLE
ARTGAAQVEGGVHGLVSYEKKSF

Other information
Ka divergence:0.173642KaKs divergence:-0.447266
GC content 1 (%):46GC content 2 (%):46GC content divergence:0
Length 1 (bp):1509Length 2 (bp):1512Length divergence:0.001
MFE 1 (kcal):-461MFE 2 (kcal):-480.05MFE divergence0.02