Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G16360-AT1G79450
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):LEM3 (ligand-effect modulator 3) family protein / CDC50 family protein
Function (paralog2):ALA-interacting subunit 5

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.58445456972033
Log2 mRNA fold difference:1.2260250341894
Log2 TE fold difference:-0.61657983146825
Sequences
Protein sequence

MSTKKHNLLANFASSDSRFTQQELPACKPILTPKWVILTFLVSGVVFIPLGVICLFASQG
VIEIVDRYDTDCIPLSSRDNKVRYIQGLEDKRCNRTITVTKTMKNPVYVYYQLENYYQNH
RRYVKSRQDGQLRSPKDEHETKSCAPEDTLGGQPIVPCGLVAWSLFNDTYDFTRNNQKLP
VNKKDISWKSDRESKFGKNVFPKNFQKGSLIGGKSLDQDIPLSEQEDLIVWMRTAALPTF
RKLYGKIDTDLQAGDTIKVLLQNNYNTYSFNGKKKLVLSTTSWLGGRNDFLGIAYLTVGS
ICLFLAVSFSVLYLAKPRQLGDPSYLSWNRSAGGGR

MSSTAASSTVGGGGSSEISGVKKTSKRPKYSRFTQQELPACKPILTPRWVILTFLVAGVV
FIPLGVICLFASQGVVEIVDRYDTDCIPTSSRNNMVAYIQGEGDKICKRTITVTKAMKHP
VYVYYQLENFYQNHRRYVKSRNDAQLRSPKEEHDVKTCAPEDNVGGEPIVPCGLVAWSLF
NDTYSFSRNSQQLLVNKKGISWKSDRENKFGKNVFPKNFQKGAPIGGGTLNISKPLSEQE
DLIVWMRTAALPTFRKLYGKIETDLHAGDTITVLLQNNYNTYSFNGQKKLVLSTTSWLGG
RNDFLGIAYLTVGSICLFLAVTFAVLYLVKPRQLGDPSYLSWNRSAGGLQ

Other information
Ka divergence:-0.220155KaKs divergence:-0.109091
GC content 1 (%):40GC content 2 (%):44GC content divergence:0.048
Length 1 (bp):1011Length 2 (bp):1053Length divergence:0.02
MFE 1 (kcal):-285.23MFE 2 (kcal):-306.7MFE divergence0.036