Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G16390-AT1G79360
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):organic cation/carnitine transporter 3
Function (paralog2):organic cation/carnitine transporter 2

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-2.6194611042537
Log2 mRNA fold difference:-2.1311654694254
Log2 TE fold difference:-0.28693709946444
Sequences
Protein sequence

MADSTRPLLSDFNSSESNLPPPRSLEETIERCIGDFGWAQFLQAALVSFAWFFDAQQTFI
TVFTDSQPMWHCDNSDRVDSVCNTSSSNLCTLPNQTWSWDLNPHVSIISEWGLQCAGSFL
KGFPASSFFLGCLIGGLALSTLADSSLGRKNMLLLSCLIMSLSSMLTAFSTSIWVYAFLR
FLNGCGRATIGTCALVLSTELVGKKWRGQVGAMGFFCFTLGFLSLPMLGYINEGNSWRNL
YVWTSIPTLIYCCLVRSFVRESPRWLIVKGRKEEAVSILQSIASNAITMSFTNLCFEVEN
DQSKSNPDVYDALKILVRKSWSFRRLLAAMVVGFGIGMVYYGMPLALTNLNFNLYLGVVF
NALSEFPAFLITFFFIDKINRRDALIGFTALSGISSALIAVLGQQLGSLQIVLELVSFFS
ACTAFNMTLIYTIEMFPTCVRNSAISMVRQALVFGGVFSPVMVAAGRENQFWSYGLFGLI
IGLCGLFVFGLPETRGSVLCDTMDEEEYKTLAKRQFIG

MAEPTQPLLTDSNSSSPRSLDDTIESYIGSFGWAQFLQAALVSFSGVFDAQQTFISVFTD
SEPTWHCTDSNSICHESISNICILPKTAWSWDYSPHVSVISEWGLQCAGSFVKGLPESSF
FVGCLIGGLVLSTLADSSLGRKNMLFLSCLVMAISTMLTVFSPNIWVYAVLRFVNGFGRA
TIGTCALVLSTELVGKKWRGRVGIMSFFGFMLGFLSLPLMAYMNRGSSWRILYAWTSIPT
IIYCVLVRFFVCESPRWLFVRGRREEAISILKRVASIPSTDVSSGGAISMSFSSLPFEED
EEKPSTNVNIFTTMKVLVEKRWALKRLSAVMAIAFGIGLVYYGMPLALSNLDFNIYLSAA
FNALMDLPANLITLFLVDKLSRRNALIGFTALGGVSSVLIFALHNMRIGNHGALQLALEL
ISYFSACSAFNMEMIYTIELFPTCVRNSAIAMARQALVLGGVFSPIMVAAGRKNAFWSFG
LFGLAIGLLGLFAVGLPETRGSDLCDTMDEEECKDRRSKVAVNNVIA

Other information
Ka divergence:0.117112KaKs divergence:-0.105903
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):1557Length 2 (bp):1584Length divergence:0.009
MFE 1 (kcal):-492MFE 2 (kcal):-505.22MFE divergence0.013