Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G16420-AT1G79340
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):metacaspase 8
Function (paralog2):metacaspase 4

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:5.0282198607977
Log2 mRNA fold difference:4.2688074155598
Log2 TE fold difference:0.83427204735237
Sequences
Protein sequence

MAKKALLIGINYPGTAVELRGCVNDVHRMQKCLIELYGFANKDIVIMIDTDKSCIQPTGK
NICDELDNLIASGQSGDFLVFHYSGHGTRIPPGIEDSEDPTGFDECITPCDMNLIKDQQF
REMVSRVKEGCQLTIISDSCHSGGLIQEVKEQIGESHMKPVDKVKEQIEESHMKQPKLGI
ASYFLNIVMNLLATCGVSKSQRDRGGGEESFRGEIELEKDETLDIKTRYLPFESYLSLLK
EQTGQTNIEPVRIRQTLLKLFGEDPSPNRQRGLSDLGNCEVDAGDSGASRLNAVTDNGIL
LSGCQTDQRSEDVYVTRTGKAYGAFSDAIQMILSAPRKDKKKITNKELVSEARVFLKKRG
YSQRPGLYCHDRFVDKPFICY

MTKKAVLIGINYPGTKAELRGCVNDVRRMYKCLVERYGFSEENITVLIDTDESSTQPTGK
NIRRALADLVESADSGDVLVVHYSGHGTRLPAETGEDDDTGFDECIVPCDMNLITDDDFR
DLVDKVPPGCRMTIISDSCHSGGLIDEAKEQIGESTKKEAEDEDESEESSSRFGFRKFLR
SKVEGAIESRGFHIGGNKKDEDEAEEIETKEIELEDGETIHAKDKSLPLQTLIDILKQQT
GNDNIEVGKIRPSLFDAFGDDSSPKVKKFMKVILGKLQAGNGEEGGLMGMLGKLASGFLE
GKLNDEDYVKPAMQTHVGSKEEVYAGGSRGSVPLPDSGILISGCQTDQTSADATPAGKPT
EAYGAMSNSIQTILEETDGEISNREMVTRARKALKKQGFTQQPGLYCHDGYANAPFIC

Other information
Ka divergence:-0.506851KaKs divergence:-0.676259
GC content 1 (%):43GC content 2 (%):47GC content divergence:0.044
Length 1 (bp):1146Length 2 (bp):1257Length divergence:0.046
MFE 1 (kcal):-320.89MFE 2 (kcal):-402.4MFE divergence0.113