Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G16440-AT1G79250
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):root hair specific 3
Function (paralog2):AGC kinase 1.7

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.48827146564864
Log2 mRNA fold difference:-1.5294224921689
Log2 TE fold difference:1.0252919154942
Sequences
Protein sequence

MLLKPGNKLVSPETSHHRDSASNSSNHKCQQQKPRKDKQKQVEQNTKKIEEHQIKSESTL
LISNHNVNMSSQSNNSESTSTNNSSKPHTGGDIRWDAVNSLKSRGIKLGISDFRVLKRLG
YGDIGSVYLVELKGANPTTYFAMKVMDKASLVSRNKLLRAQTEREILSQLDHPFLPTLYS
HFETDKFYCLVMEFCSGGNLYSLRQKQPNKCFTEDAARFFASEVLLALEYLHMLGIVYRD
LKPENVLVRDDGHIMLSDFDLSLRCSVNPTLVKSFNGGGTTGIIDDNAAVQGCYQPSAFF
PRMLQSSKKNRKSKSDFDGSLPELMAEPTNVKSMSFVGTHEYLAPEIIKNEGHGSAVDWW
TFGIFIYELLHGATPFKGQGNKATLYNVIGQPLRFPEYSQVSSTAKDLIKGLLVKEPQNR
IAYKRGATEIKQHPFFEGVNWALIRGETPPHLPEPVDFSCYVKKEKESLPPAATEKKSKM
FDEANKSGSDPDYIVFEYF

MLTKPGKKLDSSESTHHTTSSNYPPLDIVHQTPQPRKEMQQKPLFDPKKMDNLIKPEPAG
FTNHHRPNPSPKIPSSPGSNMTESQSNLNTKPNNNNSNNNSNMSSRSNSIESTSSNPSKP
HTGGDIRWDAVNTLTSKGVQLGISDFRLLKRLGYGDIGSVYLVELRGTITYFAMKVMDKA
SLASRNKLLRAQTEREILSQLDHPFLPTLYSHFETDKFYCLVMEFCGGGNLYSLRQKQPN
KCFTEDAARFFASEVLLALEYLHMLGIVYRDLKPENVLVRDDGHIMLSDFDLSLRCSVSP
TLVKSSSVHAAGGGSGSSRPVGLIDEDAAVQGCIQPSTFFPRILQSSKKNRKAKSDFGLF
VNGSMPELMAEPTNVKSMSFVGTHEYLAPEIIRGEGHGSAVDWWTFGIFIYELLYGATPF
KGQGNRATLHNVIGQALRFPEVPHVSSAARDLIKGLLVKEPQKRIAYKRGATEIKQHPFF
EGVNWALIRSATPPHVPEPVDFSCYASKDKESMAAVDGGGKKNNNGAGGGCSTGGGDNKP
NGDCNDPDYIDFEYF

www.000webhost.com

Other information
Ka divergence:-0.171671KaKs divergence:-0.120509
GC content 1 (%):44GC content 2 (%):47GC content divergence:0.033
Length 1 (bp):1500Length 2 (bp):1668Length divergence:0.053
MFE 1 (kcal):-437.06MFE 2 (kcal):-504.61MFE divergence0.072