Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G16460-AT1G79230
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):rhodanese homologue 2
Function (paralog2):mercaptopyruvate sulfurtransferase 1

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:1.3490582994926
Log2 mRNA fold difference:0.39479494273133
Log2 TE fold difference:0.90161220230786
Sequences
Protein sequence

MKRAFSSQLRSAYPASKSTHFGRVMASSGSEAKANYAPISTNEPVVSVDWLHSNLGDADI
KVLDASWYMAHEQRNPIQEYQVAHIPGALFFDLNGIADRKTNLRHMLPSEEAFAAGCSAL
GIENNDGVVVYDGMGLFSAARVWWMFRVFGHDKVWVLDGGLPKWRASGYDVESSVSNDAI
LKASAATEAIEKIYQGQTISPITFQTKFRPHLVLALDQVKENIEDKTYQHIDARSKARFD
GIAPEPWKGLPSGHIPGSKCVPFPLMFDSSQTLLPAEELKKQFEQEDISLDSPIAASCGT
GVTACILALGLYRLGKTNVAIYDGSWTEWATAPNLPIVGSSS

MASTLFSRTFLAASHRLITPSLPQKIFNPATFLSRSLHSQLGSASTAYKSTTWARRAMAS
TGVETKAGYSTSSVSTSEPVVSVDWLHANLREPDLKILDASWYMPDEQRNPIQEYQVAHI
PRALFFDLDGISDRKTSLPHMLPTEEAFAAGCSALGIDNKDEVVVYDGKGIFSAARVWWM
FRVFGHEKVWVLDGGLPRWRASGYDVESSASGDAILKASAASEAIEKIYQGQTVSPITFQ
TKFQPHLVWTLDQVKNNMEDPTYQHIDARSKARFDGTAPEPRKGIRSGHIPGSKCIPFPQ
MFDSCNTLLPAEELKKRFDQEDISLDKPIMASCGTGVTACILAMGLHRLGKTDVPIYDGS
WTEWATQPDLPIESVESSS

www.000webhost.com

Other information
Ka divergence:-0.26059KaKs divergence:-0.358322
GC content 1 (%):44GC content 2 (%):45GC content divergence:0.011
Length 1 (bp):1029Length 2 (bp):1140Length divergence:0.051
MFE 1 (kcal):-312.45MFE 2 (kcal):-351.16MFE divergence0.058