Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G16470-AT1G79210
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):proteasome subunit PAB1
Function (paralog2):N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.48957487116642
Log2 mRNA fold difference:-0.022670601267973
Log2 TE fold difference:-0.46876744183663
Sequences
Protein sequence

MGDSQYSFSLTTFSPSGKLVQIEHALTAVGSGQTSLGIKASNGVVIATEKKLPSILVDEA
SVQKIQHLTPNIGVVYSGMGPDFRVLVRKSRKQAEQYLRLYKEPIPVTQLVRETATVMQE
FTQSGGVRPFGVSLLVAGYDDKGPQLYQVDPSGSYFSWKASAMGKNVSNAKTFLEKRYTE
DMELDDAIHTAILTLKEGFEGEISSKNIEIGKIGADKVFRVLTPAEIDDYLAEVE

MGDSQYSFSLTTFSPSGKLVQIEHALTAVGSGQTSLGIKASNGVVIATEKKLPSILVDEA
SVQKIQHLTPNIGTVYSGMGPDFRVLVRKSRKQAEQYLRLYKEPIPVTQLVRETATVMQE
FTQSGGVRPFGVSLLVAGYDDKGPQLYQVDPSGSYFSWKASAMGKNVSNAKTFLEKRYTE
DMELDDAIHTAILTLKEGFEGEISSKNIEIGKIGTDKVFRVLTPAEIDDYLAEVE

Other information
Ka divergence:1KaKs divergence:0.989362
GC content 1 (%):43GC content 2 (%):44GC content divergence:0.011
Length 1 (bp):708Length 2 (bp):708Length divergence:0
MFE 1 (kcal):-205.22MFE 2 (kcal):-221.72MFE divergence0.039