Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G16490-AT1G79180
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):myb domain protein 58
Function (paralog2):myb domain protein 63

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.97107188469003
Log2 mRNA fold difference:1.2273250047932
Log2 TE fold difference:-2.1775428831746
Sequences
Protein sequence

MGKGRAPCCDKTKVKRGPWSHDEDLKLISFIHKNGHENWRSLPKQAGLLRCGKSCRLRWI
NYLRPDVKRGNFSAEEEDTIIKLHQSFGNKWSKIASKLPGRTDNEIKNVWHTHLKKRLSS
ETNLNADEAGSKGSLNEEENSQESSPNASMSFAGSNISSKDDDAQISQMFEHILTYSEFT
GMLQEVDKPELLEMPFDLDPDIWSFIDGSDSFQQPENRALQESEEDEVDKWFKHLESELG
LEENDNQQQQQQHKQGTEDEHSSSLLESYELLIH

MGKGRAPCCDKTKVKRGPWSPEEDIKLISFIQKFGHENWRSLPKQSGLLRCGKSCRLRWI
NYLRPDLKRGNFTSEEEETIIKLHHNYGNKWSKIASQLPGRTDNEIKNVWHTHLKKRLAQ
SSGTADEPASPCSSDSVSRGKDDKSSHVEDSLNRETNHRNELSTSMSSGGSNQQDDPKID
ELRFEYIEEAYSEFNDIIIQEVDKPDLLEIPFDSDPDIWSFLDTSNSFQQSTANENSSGS
RATTEEESDEDEVKKWFKHLESELGLEEDDNQQQYKEEESSSSSLLKNYELMIH

Other information
Ka divergence:0.0439795KaKs divergence:-0.646374
GC content 1 (%):41GC content 2 (%):42GC content divergence:0.012
Length 1 (bp):825Length 2 (bp):885Length divergence:0.035
MFE 1 (kcal):-224.46MFE 2 (kcal):-243.9MFE divergence0.042