Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G16500-AT1G79160
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.5557446005186
Log2 mRNA fold difference:1.4194758391213
Log2 TE fold difference:0.10046773847059
Sequences
Protein sequence

MAADVSSLVRILSRFKDDRTVVKDSTGPRSTVALMTRDLLGIGGCVGGGGGGDEQSLELD
LDVQVPNGWEKRLDLKSGKVYLQQQCNSTSSSSSSHHHHHHHEDQTNQTVPRFQDLNVPP
ISDKFPAKPLLSLFDDDDDTSLELKLVPSSISRPLPPPLSSFSPNQSLSYLSSVCTLDKV
KLALERAEKDTKKRQSPEDDGVYDGTASATVAASQVAAGCPGCLSYVFVAKNNPKCPRCH
SFVPLPAMKKPKIDLNISM

MILDMAADVSSLVRLLSGYKDDRAVVKDSAGAKSSAALMTRDLLGNGRGGGGDRSLELDL
DLQVPTGYEKRLDLKSGKVYLQRCNSTSSSSITNADQTNQTVPTFQDLNFPPPTLNNSPL
LNLFDDTTPELKLLPSSRSSRPNTSNLQSVCTLDKVKSALERAERDPAMFKKRQSPDDTV
YDHYRTEAVASPVVAGCPGCLSYVLVMMNNPKCPRCDTIVPLPTNPMKKKPKIDLNISI

Other information
Ka divergence:-0.0943459KaKs divergence:0.976588
GC content 1 (%):48GC content 2 (%):47GC content divergence:-0.011
Length 1 (bp):780Length 2 (bp):720Length divergence:-0.04
MFE 1 (kcal):-242.34MFE 2 (kcal):-219.42MFE divergence-0.05