Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G16680-AT1G79030
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Chaperone DnaJ-domain superfamily protein
Function (paralog2):Chaperone DnaJ-domain superfamily protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:0.67905263599071
Log2 mRNA fold difference:-0.1587899098248
Log2 TE fold difference:0.844500317809
Sequences
Protein sequence

MEDIGLVKQGWIWLQSQKHLCLWFCTATQCFGEKTEALAERHWPLVCSGCGKLLGLLSLS
FVYWKDCILRGFQSSVKFGSAALLLIMWSCFLSLTSVSCLVYVLLGMGAAGAVVLYLGRT
PGIFIVGLFGILILWMYANFWITGTLFIVGGYLFSLNHARVVVLMATMYAMYCVKVRLGW
PGVILSMNLAFLSNDIFICLLQWCDTVSEKTQVEEPTKPETVIDEEFPGEFEYSSVPAEE
AEKKVHEDKSSTKPASSSTVVSNMKEISTVKVVKIETDSADEMKRILDSLNHYEALGLPL
FKKIDAALLKKDYRKKAMLVHPDKNMGSPLASESFKKLQSAYEVLSDSVKRRDYDELLKK
EESRTKIVCQSSHASSHQNSAAYRSEESRRIHCTKCGNSHIWVCTNRSKAKARWCQECGQ
YHQAKDGDGWVEHKGTLVFEKAHKIEIPRAFVCAEGKVFDVSEWAICQGMACRPNTHRPS
FHVNMVGLEKATQRSKSSRFPWDLDVEMMDEDEEEFELWLQQALASGLFCETSKRRKSWS
PFKLTKKQSRRTST

MEDIGLVKQGWKWMQSQKHMCSDACSAMRCFGEMIGGLVERHWPLVCSGCGKLLGLLQLS
VLYWKDCIFRGFHCSAKLGSAALLLIMWSCFLSLTSLSCLLYVLLSMGAAAAVVLNLGCT
PGLFIVGLFGILILWMYANFWITGTLFIVGGYLFSLNHARVVVLVAGLYAMYCVKVRLGW
LGLFLSINLAFLSNDILNCLLQWCDNLSEKPQHEEPKKPKETIIEEDYSREFEYPSVPVE
DETETKIHENKSSAKPTAPSTVVNTVKEISSVKIVKIEESSSADEMKRILNSLNHYEALG
VPRHKKIDAAVLKKEYRKKAMLVHPDKNMGSPLASESFKKLQSAYEVLSDFVKKRDYDEQ
LRKEESRTRSVCQTSHASSHQSGPDYRSDESRRIHCTKCGNSHIWICTNRTKAKARWCQD
CGQYHQAKDGDGWVELKGTLPFERAHKIEIPRAFVCAESKIFDVSEWAICQGMACRPNTH
RPSFHVNMVGLEKTTQRSNSSRFPWDLDVEMMDEDEEEFELWLQQALASGLFCETSKRRK
SWSPFKLGQMKSKKQWRRTST

www.000webhost.com

Other information
Ka divergence:-0.20641KaKs divergence:-0.0514096
GC content 1 (%):42GC content 2 (%):42GC content divergence:0
Length 1 (bp):1665Length 2 (bp):1686Length divergence:0.006
MFE 1 (kcal):-498.93MFE 2 (kcal):-491.04MFE divergence-0.008