Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G16690-AT1G79020
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Enhancer of polycomb-like transcription factor protein
Function (paralog2):Enhancer of polycomb-like transcription factor protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.56301545400443
Log2 mRNA fold difference:0.21623308651443
Log2 TE fold difference:0.43105284605741
Sequences
Protein sequence

MSRLSFRPRPLDIHKKLPILKSFKDFEDEDNPSSITRNSQLLRISAVEVVDNEVQPPVPS
KKLISEIPTPQYLVVDTYERDYSRTFNQPASYLRARGARAELGEFVEYDLDNDDDDWLYE
YNKETMILSPEMLEIVIFKLEVLDHKARERAGVITPTLGLPVPVLLQPDAAGEALKYLSI
KYGVFHAIYSYWKNKREIWQKPILRRLQPPPPVNDTNPYNVFRPREKAHRLHARRMQQRE
NNAQSFEKLRQVRRNLDQAKTILEALIKREEKKRDFMASEVSLQRIQLKYKNETELLEDS
LALAGFPLSTAYRFGSSEDEFMDSDDPTTTQTCTRPSFTPHRRFTDSNLARAQAGSIKQE
ARRLGWLHKLNPNEPVMLFTKALVPDKLAAAGIIPPSDARSGRARFQGRMGRGGRIVFDR
WNPLNQAHINCGNTLYIAP

MSRLSFRPRPLDIHKKLPILKSFKDFEDDETPTSTTRNSQLLRIASVEVDNEVAPVPSKK
PASEIPTPQFVIVDTYERDYSPTFGQPASYLRARGARSELGEFVEYDLDNEDEDWLYEFD
KDKKELPPEKLEIIIFKLEVLDHKTRERAGVITPTLGSPVPVLLQFDAASDVLQVLSINY
GTFQAIFNYWKEKRKRWQKPILRRLQPPPPVNDTNPYNVFRPREKVHRLHTRRMQRRENN
VQSFEKLRQVRRNLGQAQSILEALIKREEKKRDVMDSEVSLQRIQLQYRHETELLEDSLA
MPGFQPTTTSYKFGSSDDELMDSDDHTSTRVRTRPAVIPSSRFTNLNLNASHPGGIKQEV
RRRQSQHGWLHRLDPNEPVMLFTKPLVPDKLAAAGIVPPTPDSSPGQPPSRFQGRIGRGG
RIIFDRWNPLMQSHINCGNSYYIAPNHRSTNFD

www.000webhost.com

Other information
Ka divergence:-0.223859KaKs divergence:-0.426841
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):1320Length 2 (bp):1362Length divergence:0.016
MFE 1 (kcal):-385.33MFE 2 (kcal):-391.29MFE divergence0.008