Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G16700-AT1G79010
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Alpha-helical ferredoxin
Function (paralog2):Alpha-helical ferredoxin

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.45944423403048
Log2 mRNA fold difference:0.11296096927773
Log2 TE fold difference:0.37355266149129
Sequences
Protein sequence

MASLLARRSFSALRARHLAFSGQGLQGSHLCGLQSRAISYGSNKDDEEAEQLAKEISKDW
STVFERSMNTLFLTEMVRGLSLTLKYFFDPKVTINYPFEKGPLSPRFRGEHALRRYPTGE
ERCIACKLCEAVCPAQAITIEAEEREDGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEG
PNFEFATETHEELLYDKEKLLENGDRWETEIAENLRSESLYR

MASILARRSLNTLRARHLVLSGQALQGSHLSRLQSRGISYGSNKDDEEAEQLSKEISKDW
NTVFERSINTLFLTEMVRGLSLTLKYFFDPKVTINYPFEKGPLSPRFRGEHALRRYPTGE
ERCIACKLCEAVCPAQAITIEAEEREDGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEG
PNFEFATETHEELLYDKEKLLENGDRWETEIAENLRSESLYR

www.000webhost.com

Other information
Ka divergence:0.08785KaKs divergence:0.453541
GC content 1 (%):47GC content 2 (%):47GC content divergence:0
Length 1 (bp):669Length 2 (bp):669Length divergence:0
MFE 1 (kcal):-216.81MFE 2 (kcal):-204.5MFE divergence-0.029