Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G16710-AT1G79000
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):histone acetyltransferase of the CBP family 12
Function (paralog2):histone acetyltransferase of the CBP family 1

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:1.0964034854971
Log2 mRNA fold difference:1.2292104537705
Log2 TE fold difference:-0.027897657347661
Sequences
Protein sequence

MNVQAHMSGQRSGQVPNQGTVPQNNGNSQMQNLVGSNGAATAVTGAGAATGSGTGVRPSR
NIVGAMDHDIMKLRQYMQTLVFNMLQQRQPSPADAASKAKYMDVARRLEEGLFKMAVTKE
DYMNRSTLESRITSLIKGRQINNYNQRHANSSSVGTMIPTPGLSQTAGNPNLMVTSSVDA
TIVGNTNITSTALNTGNPLIAGGMHGGNMSNGYQHSSRNFSLGSGGSMTSMGAQRSTAQM
IPTPGFVNSVTNNNSGGFSAEPTIVPQSQQQQQRQHTGGQNSHMLSNHMAAGVRPDMQSK
PSGAANSSVNGDVGANEKIVDSGSSYTNASKKLQQGNFSLLSFCPDDLISGQHIESTFHI
SGEGYSTTNPDPFDGAITSAGTGTKAHNINTASFQPVSRVNSSLSHQQQFQQPPNRFQQQ
PNQIQQQQQQFLNQRKLKQQTPQQHRLISNDGLGKTQVDSDMVTKVKCEPGMENKSQAPQ
SQASERFQLSQLQNQYQNSGEDCQADAQLLPVESQSDICTSLPQNSQQIQQMMHPQNIGS
DSSNSFSNLAVGVKSESSPQGQWPSKSQENTLMSNAISSGKHIQEDFRQRITGMDEAQPN
NLTEGSVIGQNHTSTISESHNLQNSIGTTCRYGNVSHDPKFKNQQRWLLFLRHARSCKPP
GGRCQDQNCVTVQKLWSHMDNCADPQCLYPRCRHTKALIGHYKNCKDPRCPVCVPVKTYQ
QQANVRALARLKNESSAVGSVNRSVVSNDSLSANAGAVSGTPRCADTLDNLQPSLKRLKV
EQSFQPVVPKTESCKSSIVSTTEADLSQDAERKDHRPLKSETMEVKVEIPDNSVQAGFGI
KETKSEPFENVPKPKPVSEPGKHGLSGDSPKQENIKMKKEPGWPKKEPGCPKKEELVESP
ELTSKSRKPKIKGVSLTELFTPEQVREHIRGLRQWVGQSKAKAEKNQAMENSMSENSCQL
CAVEKLTFEPPPIYCTPCGARIKRNAMYYTVGGGETRHYFCIPCYNESRGDTILAEGTSM
PKAKLEKKKNDEEIEESWVQCDKCQAWQHQICALFNGRRNDGGQAEYTCPYCYVIDVEQN
ERKPLLQSAVLGAKDLPRTILSDHIEQRLFKRLKQERTERARVQGTSYDEIPTVESLVVR
VVSSVDKKLEVKSRFLEIFREDNFPTEFPYKSKVVLLFQKIEGVEVCLFGMYVQEFGSEC
SNPNQRRVYLSYLDSVKYFRPDIKSANGEALRTFVYHEILIGYLEYCKLRGFTSCYIWAC
PPLKGEDYILYCHPEIQKTPKSDKLREWYLAMLRKAAKEGIVAETTNLYDHFFLQTGECR
AKVTAARLPYFDGDYWPGAAEDIISQMSQEDDGRKGNKKGILKKPITKRALKASGQSDFS
GNASKDLLLMHKLGETIHPMKEDFIMVHLQHSCTHCCTLMVTGNRWVCSQCKDFQLCDGC
YEAEQKREDRERHPVNQKDKHNIFPVEIADIPTDTKDRDEILESEFFDTRQAFLSLCQGN
HYQYDTLRRAKHSSMMVLYHLHNPTAPAFVTTCNVCHLDIESGLGWRCEVCPDYDVCNAC
YKKEGCINHPHKLTTHPSLADQNAQNKEARQLRVLQLRKMLDLLVHASQCRSPVCLYPNC
RKVKGLFRHGLRCKVRASGGCVLCKKMWYLLQLHARACKESECDVPRCGDLKEHLRRLQQ
QSDSRRRAAVMEMMRQRAAEVAGTSG

MNVQAHMSGQVSNQGTMSQQNGNSQMQNLVGGGSAPATGAGLGPSRVSPVDNDILKLRQA
MRIRIFNILQQKQPSPADEASKAKYMDVARRLEEGLFKIANTKEDYVNPSTLEPRLASLI
KGRQLNNYNQRHANSSSVGTMIPTPGLQHSGGNPNLMITSSGDATMAGSNNITTSAMNTG
NLLNSGGMLGGNLSNGYQHSSSNFGLGSGGNMSSMSSQRNTGQMMPTPGFVNSSTNNNSN
NGQSYLSVEASNNSGGFSTAPMMVPQTQQQQLRQDIGGQNSRMLQNHGSQMGVGLRPGMQ
QKLSNVSNSSINGGVGMNAKSVDSGTSYTNPIRNSQQAYDNLQRSGMQGDGYGTNNSDPF
GSGNLYGAVTSVGMMTNTQNANTASFQAVSRTSSSLSHQQQQFQQQPNRFQQQPNQFHQQ
QQQFLHQQQLKQQSQQQQRFISHDAFGQNNVASDMVTHVKHEPGMENPSESIHSQTPEQF
QLSQFQNQYQNNAEDRHAGSQILPVTSQSDMCTSVPQNSQQIQQMLHPHSMASDSVNGFS
NLSVGVKTESGMRGHWQSQSQEHTQMSNSMSNERHIQEDFRQRMSGTDEAQPNNMSGGSI
IGQNRVSTTSESLNPQNPTATTCRNGNGNRDPRFKNQQKWLLFLRHARHCKAPEGKCPDR
NCVTVQKLWKHMDSCAAPQCSYPRCLPTKTLINHHRSCKEPNCPVCIPVKAYLQQQANAR
SLARLKNETDAARSVNGGGISSDAVQTSAGAKSCTSPGADISGHLQPSLKRLKVEQSSQP
VDVETESCKSSVVSVTEAQSSQYAERKDHKHSDVRAPSKYFEVKAEVSDFSVQTRPGFKD
TKIGIAENIPKQRPVSQPDKQDLSDVSPMQETTKVEKEPESLKKENLAESTEHTSKSGKP
EIKGVSLTELFTPEQVREHIRGLRQWVGQSKAKAEKNQAMEHSMSENSCQLCAVEKLTFE
PPPIYCTPCGARIKRNAMYYTVGAGDTRHYFCIPCYNESRGDTILAEGTPMPKARLEKKK
NDEETEEWWVQCDKCEAWQHQICALFNGRRNDGGQAEYTCPYCFIAEVEQSKRKPLPQSA
VLGAKDLPRTILSDHIEQRLFKRLKQERTERARAQGKSYDEIPTAESLVIRVVSSVDKKL
EVKPRFLEIFREDSYPTEFAYKSKVVLLFQKIEGVEVCLFGMYVQEFGSECAFPNQRRVY
LSYLDSVKYFRPEVRSYNGEALRTFVYHEILIGYLEYCKLRGFTSCYIWACPPLKGEDYI
LYCHPEIQKTPKSDKLREWYLAMLRKASKEGIVAETINLYDHFFMQTGECRAKVTAARLP
YFDGDYWPGAAEDLIYQMSQEEDGRKGNKKGMLKKTITKRALKASGQTDLSGNASKDLLL
MHRLGETIHPMKEDFIMVHLQPSCTHCCILMVSGNRWVCSQCKHFQICDKCYEAEQRRED
RERHPVNFKDKHALYPVEIMDIPADTRDKDEILESEFFDTRQAFLSLCQGNHYQYDTLRR
AKHSSMMVLYHLHNPTAPAFVTTCNACHLDIETGQGWRCEVCPDYDVCNACFSRDGGVNH
PHKLTNHPSLADQNAQNKEARQLRVLQLRKMLDLLVHASQCRSAHCQYPNCRKVKGLFRH
GINCKVRASGGCVLCKKMWYLLQLHARACKESECHVPRCRDLKEHLRRLQQQSDSRRRAA
VMEMMRQRAAEVAGGSGINMRALNQGCHFPEEEEREQCQPSSQMTRVLRDSGLMGFGWLI
F

www.000webhost.com

Other information
Ka divergence:-0.150102KaKs divergence:0.0217772
GC content 1 (%):43GC content 2 (%):44GC content divergence:0.011
Length 1 (bp):5121Length 2 (bp):5226Length divergence:0.01
MFE 1 (kcal):-1530.41MFE 2 (kcal):-1585.5MFE divergence0.018