Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G16780-AT1G78920
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Inorganic H pyrophosphatase family protein
Function (paralog2):vacuolar H+-pyrophosphatase 2

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.45601519987906
Log2 mRNA fold difference:1.3111456142562
Log2 TE fold difference:-0.82710154954447
Sequences
Protein sequence

MLKTIYGRCFSRSQYRRIKIQRPSSGAELPRSTGFIPLPLVRRANSLQNMMMDEDVEQAT
LVSYSDKPRTFPDMRSKTYSPLIIRILRNLNVRALSVLLLLSFGGIFYMGARTSPIIVFV
FVVCIISFMLSVYLTKWVLAKDEGPPEMVQISDAIRDGAEGFLRTQYGTISKMAFLLAFV
ILCIYLFRNLTPQQEASGLGRTMSAYITVAAFLLGALCSGIAGYVGMWVSVRANVRVSSA
ARRSAREALQIAVRAGGFSALVVVGMAVIGIAILYSTFYVWLDVDSPGSMKVTDLPLLLV
GYGFGASFVALFAQLGGGIYTKGADVGADLVGKVEHGIPEDDPRNPAVIADLVGDNVGDC
AARGADLFESIAAEIISAMILGGTMAQKCKIEDPSGFILFPLVVHSFDLVISSIGILSIK
GTRNASVKSPVEDPMVVLQKGYSLTIILAVLTFGASTRWLLYTEQAPSAWLNFFMCGLVG
IITAYVFVWISRYYTDYKYEPVRTLALASSTGHGTNIIAGVSLGLESTALPVLVISVAII
SAFWLGNTSGLIDEKGNPTGGLFGTAVATMGMLSTAAYVLTMDMFGPIADNAGGIVEMSQ
QPESVREITDVLDAVGNTTKATTKGFAIGSAALASFLLFSAYMDEVSAFANVSFKEVDIA
IPEVFIGGLLGAMLIFLFSAWACAAVGRTAQEVVNEVRRQFIERPGIMDYKEKPDYGRCV
AIVASSALREMIKPGALAIISPIAVGFVFRILGYYTGQPLLGAKVVAAMLMFATVCGILM
ALFLNTAGGAWDNAKKYIETGALGGKGSDSHKAAVTGDTVGDPFKDTAGPSIHVLIKMLA
TITLVMAPIFL

MMMDEDVEQASLMSFNDRPRAFPNMRSKTYSPLIFRIIRKLNVRVLSIILLFCFGAIFYM
GASTSPIIVFVFTVCIISFLLSIYLTKWVLAKDEGPPEMVEISDAIRDGAEGFFRTQYST
ISKMAILLAFVILCIYLFRSLTPQQEAAGLGRAMSAYITVAAFLLGALCSGIAGYVGMWV
SVRANVRVSSAARRSAREALQIAVRAGGFSALVVVGMAVIGIAILYSTFYVWLGVGSPGS
MNVTDLPLLLVGYGFGASFVALFAQLGGGIYTKGADVGADLVGKVEQGIPEDDPRNPAVI
ADLVGDNVGDCAARGADLFESIAAEIISAMILGGTMAKKCKIEDPSGFILFPLVVHSFDL
IISSIGILSIKGTRDASVKSPVEDPMAVLQKGYSLTIILAVITFGASTRWLLYTEQAPSA
WFNFALCGLVGIITAYIFVWISKYYTDYKHEPVRTLALASSTGHGTNIIAGVSLGLESTA
LPVLTISVAIISAYWLGNTSGLVDENGIPTGGLFGTAVATMGMLSTAAYVLTMDMFGPIA
DNAGGIVEMSQQPESVREITDLLDAVGNTTKATTKGFAIGSAALASFLLFSAYMDEVSAF
ANVSFKEVDIAIPEVFVGGLLGAMLIFLFSAWACAAVGRTAQEVVNEVRRQFIERPGIME
YKEKPDYSRCVAIVASAALREMIKPGALAIASPIVVGLVFRILGYYTGQPLLGAKVVASM
LMFATVCGILMALFLNTAGGAWDNAKKYIETGALGGKGSEAHKAAVTGDTVGDPFKDTAG
PSIHVLIKMLATITLVMAPVFL

Other information
Ka divergence:-0.0505556KaKs divergence:0.20122
GC content 1 (%):44GC content 2 (%):45GC content divergence:0.011
Length 1 (bp):2556Length 2 (bp):2409Length divergence:-0.03
MFE 1 (kcal):-829.42MFE 2 (kcal):-793.27MFE divergence-0.022