Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G16840-AT1G78890
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.47496359459224
Log2 mRNA fold difference:-1.4253556712506
Log2 TE fold difference:0.96318472869618
Sequences
Protein sequence

MARSFSRSLSLSKGRFAAASSSLLPSSHLVSFRSQSSDRRGDLYEIDTSAASQSPSDPLI
QKLEDAVHRIFVRRAQPDWLPFVPGASYWVPPPGSGSQSHGIAQLVVKLANPLTHEESLS
TNSSHGWPSSDYFLKGVQPQLMETKTETTSNSESHSEDEEV

MARSLSPSLSLSRYRFAAASLLLPSSQTIFIRSQSSNRRSNSNHLGVIYEIDIAADPLVN
KLEDAVHRIMVRRSAPDWLPFVPGASFWVPPPRSQSHGIAKLVEKLANPISDEESISISS
VRGWPCSDYFIKGVKPQSVETEMTSNTAYHSEDEE

Other information
Ka divergence:0.142186KaKs divergence:-0.400557
GC content 1 (%):49GC content 2 (%):47GC content divergence:-0.021
Length 1 (bp):486Length 2 (bp):468Length divergence:-0.019
MFE 1 (kcal):-133.06MFE 2 (kcal):-126.6MFE divergence-0.025