Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G16860-AT1G78880
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Ubiquitin-specific protease family C19-related protein
Function (paralog2):Ubiquitin-specific protease family C19-related protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.098358902239359
Log2 mRNA fold difference:-0.052811131760799
Log2 TE fold difference:-0.13095092976621
Sequences
Protein sequence

MGSRYPSHQLSNGLFVSGRPEQPKERAPTMSAVAMPYTGGDIKRSGELGKMFDIPADGTK
SRKSGPIPGAPSRSGSFAGTAQSGPGAPMATGRMSGSLASAGSVSMKKTNSGPLSKHGEP
LKKSSGPQSGGVTRQNSGSIPILPATGLITSGPITSGPLNSSGAPRKVSGPLDSSGLMKS
HMPTVVHNQAVTTLGPEDDFSCLKSFPKPVLWLVVLIFIMGFLAGGFILGAVHNPILLVV
VAILFTVVAALFIWNICWGRRGITDFIARYPDADLRTAKNGQHVKVTGVVTCGNVPLESS
FHRVPRCVYTSTCLYEYRGWGSKPANSSHRHFTWGLRSSERHVVDFYISDFQSGLRALVK
TGSGAKVTPLVDDSVVIDFKQGSEQVSPDFVRWLGKKNLTSDDRIMRLKEGYIKEGSTVS
VIGVVQRNDNVLMIVPSSEPLAAGWQWRRCTFPTSLEGIVLRCEDSSNVDAIPV

MGSRYASHQLSNGLFVSGRPEQPKEKPPTMSSVAMPYTGGDIKKSGELGKMFDIPTDGTK
SRKSGPITGGSSRSGAQSGPVPNATGRMSGNLASAGSNSMKKTNSGPLSKHGEPLKKSSG
PQSGGVTRQNSGPIPILPTTGLITSGPITSGPLNSSGAPRKISGPLDYSGSMKTHMPSVV
HNQAVTTLAPEDDFSCMKSFPKPVLWLVILIFVMGFLAGGFILGAVHNAILLIVVAVLFT
VVAALFIWNISCERRGITDFIARYPDADLRTAKNGQYVKVTGVVTCGNVPLESSFHRVPR
CVYTSTCLYEYRGWGSKPANASHRRFTWGLRSAERHVVDFYISDFQSGLRALVKTGNGAK
VTPLVDDSVVIDFKPGNEQASPDFVRWLGKKNLTNDDRIMRLKEGYIKEGSTVSVIGVVQ
RNDNVLMIVPTTEPLAAGWQWSKCTFPASLEGIVLRCEDSSNVDAIPV

www.000webhost.com

Other information
Ka divergence:-0.158294KaKs divergence:-0.0916983
GC content 1 (%):46GC content 2 (%):46GC content divergence:0
Length 1 (bp):1425Length 2 (bp):1407Length divergence:-0.006
MFE 1 (kcal):-472.7MFE 2 (kcal):-444.82MFE divergence-0.03