Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G16890-AT1G78870
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):ubiquitin-conjugating enzyme 36
Function (paralog2):ubiquitin-conjugating enzyme 35

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.45315519733443
Log2 mRNA fold difference:-1.4137668594829
Log2 TE fold difference:0.96158837077402
Sequences
Protein sequence

MANSNLPRRIIKETQRLLSEPGNFITSFDPSPGISASPSEENMRYFNVMILGPTQSPYEG
GVFKLELFLPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQ
ALLSAPNPDDPLSENIAKHWKSNEAEAVETAKEWTRLYASGA

MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGRGVFKLELF
LPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNP
DDPLSENIAKHWKSNEAEAVDTAKEWTRLYASGA

www.000webhost.com

Other information
Ka divergence:-0.336364KaKs divergence:-0.251799
GC content 1 (%):42GC content 2 (%):44GC content divergence:0.023
Length 1 (bp):489Length 2 (bp):465Length divergence:-0.025
MFE 1 (kcal):-125.46MFE 2 (kcal):-127.31MFE divergence0.007