Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G16910-AT1G78815
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein of unknown function (DUF640)
Function (paralog2):Protein of unknown function (DUF640)

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.1352781149223
Log2 mRNA fold difference:0.23952942230363
Log2 TE fold difference:-1.248939917568
Sequences
Protein sequence

MTSTNTRNKGKCIVEGPPPTLSRYESQKSRDWNTFCQYLMTKMPPVHVWECESNHILDFL
QSRDQFGKTKVHIQGCVFFGQKEPPGECNCPLKQAWGSLDALIGRLRAAYEENGGLTEKN
PFARGGIRIFLREVRGSQAKARGVLYKKKKRLVVVGTGTSTTWT

MASHSNKGKGIAEGSSQPQSQPQPQPHQPQSPPNPPALSRYESQKRRDWNTFCQYLRNQQ
PPVHISQCGSNHILDFLQYLDQFGKTKVHIHGCVFFGQVEPAGQCNCPLKQAWGSLDALI
GRLRAAFEENGGLPERNPFAGGGIRVFLREVRDSQAKARGVPYKKRKKRKKRNPMKSHDG
EDGTTGTSSSSNLAS

Other information
Ka divergence:-0.473964KaKs divergence:0.971069
GC content 1 (%):47GC content 2 (%):49GC content divergence:0.021
Length 1 (bp):495Length 2 (bp):588Length divergence:0.086
MFE 1 (kcal):-138.3MFE 2 (kcal):-179.5MFE divergence0.13