Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G16930-AT1G78750
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):F-box/RNI-like/FBD-like domains-containing protein
Function (paralog2):F-box/RNI-like superfamily protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-2.9286628075019
Log2 mRNA fold difference:-2.6459385168618
Log2 TE fold difference:-0.30284104205416
Sequences
Protein sequence

MDDETSVKEKQRNSDRISNLPDSLLCQILSDLSTKESVCTSVLSKRWRNLWLHVPVLDLD
SNNFPDDDVFVSFVNRFLGSENEQHLERFKLIYEVNEHDASRFKSWINAVIKRRVCHFNV
HNEVDDDDELVKMPLSLYSCERLVNLQLYRVALDHPESVSLPCVKIMHLDMVKYDADSTL
EILISGCPVLEELTIVRDPNDSLEVVCVRSQSLKSFKIDSERYESQNHVVTIDAPRLEYM
NLCDHRSDSFIIHNIGPFAKVDIDVIFNVEYNDPLEPDDSSKIAMLGKFLTGLSTVSEMV
ISSDTLQVIHDYCKMEQLPQFSNLSRLHAYFEDTWWEMLPTFLESFPNLHSLVMEFDCFP
DTEQIDLSYVPQCFLSSLEFVHLKTPYVVNMQKEGRPLTGTSSKRKLAKYFLENGAALKK
LTVSASFCNIIDEIKAIPRSSTSCQVVMD

MDGAGEKRVRAKGSREVDWISNLPETLLCQVLFYLPTKDVVKSSVLSSRWRNLWKYVPGF
NLSYCDFHVRNTFSYDHNTFLRFVDSFMGFNSQSCLQSFRLEYDSSGYGEPKLALIRRWI
NSVVSRKVKYLGVLDDSCDNYEFEMPPTLYTCETLVYLTLDGLSLASPKFVSLPSLKELH
LSIVKFADHMALETLISQCPVLENLNINRSFCDDFEFTCVRSQSLLSFTHVADTDEMLNE
DLVVAIDAPKLKYLRLSDHRIASFILNDLASLVEADIDTVFNLICKKMFNPNDLNKRNMI
RDFLVGISSIKTLIIASSTLEVIYDYSRCEPLPLFRNLSSLRVDFYGYKWEMLPIFLESC
PNLKSLVVGSANYREKEGINILSVPRGFLSSLEYVKIERPLKGEAMEMKLVSYLLENSTI
LKKLTLCLDDSIKKEESVILKELNTIPRLSSACQVVIL

Other information
Ka divergence:0.170701KaKs divergence:0.0201005
GC content 1 (%):39GC content 2 (%):40GC content divergence:0.013
Length 1 (bp):1350Length 2 (bp):1377Length divergence:0.01
MFE 1 (kcal):-369.9MFE 2 (kcal):-362.44MFE divergence-0.01