Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G17010-AT1G17020
Species:Arabidopsis
Duplication type:TD
Function (paralog1):2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein
Function (paralog2):senescence-related gene 1

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:2.5889327308352
Log2 mRNA fold difference:3.2229486237957
Log2 TE fold difference:-0.76207669930646
Sequences
Protein sequence

MEAKEETPWSSILVPSVQEMVKDKMITTVPPRYVRYDQDKTEVVVHDSGLISEIPIIDMN
RLCSSTAVDSEVEKLDFACKEYGFFQLVNHGIDPSFLDKIKSEIQDFFNLPMEEKKKLWQ
TPAVMEGFGQAFVVSEDQKLDWADLFFLIMQPVQLRKRHLFPKLPLPFRDTLDMYSTRVK
SIAKILLAKMAKALQIKPEEVEEIFGDDMMQSMRMNYYPPCPQPNLVTGLIPHSDAVGLT
ILLQVNEVDGLQIKKNGKWFFVKPLQNAFIVNVGDVLEIITNGTYRSIEHRAMVNLEKER
LSIATFHNTGMDKEIGPARSLVQRQEAAKFRSLKTKDYLNGLFSRELKGKAYLDAMRIEG
K

MEAKGAAQWSSILVPSVQEMVKEKTITTVPPRYVRSDQDKTEVDDDFDVKIEIPIIDMKR
LCSSTTMDSEVEKLDFACKEWGFFQLVNHGIDSSFLDKVKSEIQDFFNLPMEEKKKFWQR
PDEIEGFGQAFVVSEDQKLDWADLFFHTVQPVELRKPHLFPKLPLPFRDTLEMYSSEVQS
VAKILIAKMARALEIKPEELEKLFDDVDSVQSMRMNYYPPCPQPDQVIGLTPHSDSVGLT
VLMQVNDVEGLQIKKDGKWVPVKPLPNAFIVNIGDVLEIITNGTYRSIEHRGVVNSEKER
LSIATFHNVGMYKEVGPAKSLVERQKVARFKRLTMKEYNDGLFSRTLDGKAYLDALRI

Other information
Ka divergence:-0.183331KaKs divergence:0.0907229
GC content 1 (%):43GC content 2 (%):42GC content divergence:-0.012
Length 1 (bp):1086Length 2 (bp):1077Length divergence:-0.004
MFE 1 (kcal):-325.95MFE 2 (kcal):-329.31MFE divergence0.005