Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G17040-AT1G78540
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):SH2 domain protein A
Function (paralog2):SH2 domain protein B

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.18848452356919
Log2 mRNA fold difference:-0.079121929227163
Log2 TE fold difference:0.27792971236813
Sequences
Protein sequence

MAGDCAIDTEKYSLLEDFNVDVEVENKAFETFSLCFWVYLLDSTTYPSAIIRQINLFCEL
GEKVHSDMSVSAPFLVLDENKKMMLLPLTLLHREAPDPVNTSSWTEVPNVSTTAKFPLQK
WVHVGCEVSRNYMRLYICGELVGEQVLTSLMTNGTNSDCARKISLFSVGGDGYSVQGFIH
SAEVLPSNLSASYHYTKDPPLWLSVDKPSTSGIELDEDGVWSVVSGTFCSLDVVLTNAIG
QPVHKDVKVVASLLYADSGTHVEKRSDFEAFLLVSYEGIELSAEDKPCNLLNGCASFKFK
LSQLSSKSDKRLFCIKFEIPEVKANYPFLETVTNQIRCISRNRDSVSSMKRIRLGEEKVS
ESKIVNGNGTSMEWRPQNHEEDNSSTDSENTEMRDSTAFRRYSIPDWIIFKYCLGNLTER
ALLLKEITNNSSDEEVSEFADQVSLYSGCSHHGYQIKMARKLIAEGTNAWNLISRNYRHV
HWDNVVIEIEEHFMRIAKCSSRSLTHQDFDLLRRICGCYEYITQENFETMWCWLFPVASA
VSRGLINGMWRSASPKWIEGFVTKEEAERSLQNQVPGTFILRFPTSRSWPHPDAGSVVVT
YVGHDLVIHHRLLTINHICDSSERYTDAKQLQDMLLAEPELSRLGRIIRGI

MASAATIETEKYSLLEDFNVDVEVDDEEYESFSLCFWVYLLNSTTFPSTIIRQVHSDMSV
SAPFLVLDENKKMMLLPLTLLHKEAPDPVDTSSWTQVPSVSTKSKFPLEKWVHVGCEVSR
NFMRLFIDGNMEGEQFVTSLLTKNAYPECPRKISLFSVGGDGYSVQGFIQCAEVLPASDH
VEHHYMKDPPLMLSVNKSSSSGIKLDDCGVWQASCKEMFSLDVLLSNAIGQPVHKDVEVV
ASLLYADTLPEAKMGEAEAPLLIRDEGVQFSSDDRPIKLLNGRSSFKLKISQLSSNSDDR
LFWIKFGIRNAKDYPFLQAVSNPIRCISVSPEVQPVSVTPKRLTNIDHLSSTESPDLLQN
TSSVKRIRLGKESVSGSEESYQQCNSHPQTSRQFENGNGMRLHEEDNSSIDSENSEMRYT
ISDSTIFKYCLGNLIDKALLLKEITNNSSDDEVLEFANQVSLYSGCSHHSYQINMARELI
AEGTNAWILISRNNQHVHWDNVVYEIEEHFMRISKCSSRSLTHQDFELLRRISGCYEYIT
QENFEKMWCWLFPVAYSISRGLINGMWRSSSPKWIEGFITKEEAEHSLQGQEPGTFILRF
PISRTWPHPDAGSLVVTYVGHDFALHHKQLKIDNICESSERYMDAKPLQDMLLAEPELSR
LGRNVVLLWIFVCAGSKEATECYAFSNIQTLNLSYS

Other information
Ka divergence:-0.0420314KaKs divergence:-0.493353
GC content 1 (%):41GC content 2 (%):41GC content divergence:0
Length 1 (bp):1956Length 2 (bp):2091Length divergence:0.033
MFE 1 (kcal):-574.46MFE 2 (kcal):-587.08MFE divergence0.011