Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G17050-AT1G78510
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):solanesyl diphosphate synthase 2
Function (paralog2):solanesyl diphosphate synthase 1

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.30534722427007
Log2 mRNA fold difference:-0.028382910696782
Log2 TE fold difference:0.33470382642247
Sequences
Protein sequence

MMMSCRNIDLGTSVLDHSCSSSSTSRRFLFGNSSKTVCMIGGRSCVGNLVFLRRDLATCR
AVPAKSKENSLVNGIGQDQTVMLNLRQESRKPISLETLFEVVADDLQRLNDNLLSIVGAE
NPVLISAAEQIFSAGGKRMRPGLVFLVSRATAELAGLKELTVEHRRLGEIIEMIHTASLI
HDDVLDESDMRRGRETVHELFGTRVAVLAGDFMFAQASWYLANLENLEVIKLISQVIKDF
ASGEIKQASSLFDCDVKLDDYMLKSYYKTASLVAASTKGAAIFSKVESKVAEQMYQFGKN
LGLSFQVVDDILDFTQSTEQLGKPAANDLAKGNITAPVIFALENEPRLREIIESEFCEPG
SLEEAIEIVRNRGGIKKAQELAKEKAELALKNLNCLPRSGFRSALEDMVMFNLERID

MMTSCRNIDLGTMMMACGCGRRQFPSLAKTVCKFTSSNRSYGGLVGSCKAVPTKSKEISL
LNGIGQSQTVSFDLKQESKQPISLVTLFELVAVDLQTLNDNLLSIVGAENPVLISAAEQI
FGAGGKRMRPGLVFLVSHATAELAGLKELTTEHRRLAEIIEMIHTASLIHDDVLDESDMR
RGKETVHELFGTRVAVLAGDFMFAQASWYLANLENLEVIKLISQVIKDFASGEIKQASSL
FDCDTKLDEYLLKSFYKTASLVAASTKGAAIFSRVEPDVTEQMYEFGKNLGLSFQIVDDI
LDFTQSTEQLGKPAGSDLAKGNLTAPVIFALEREPRLREIIESEFCEAGSLEEAIEAVTK
GGGIKRAQELAREKADDAIKNLQCLPRSGFRSALEDMVLYNLERID

Other information
Ka divergence:-0.0228394KaKs divergence:-0.0740591
GC content 1 (%):42GC content 2 (%):45GC content divergence:0.034
Length 1 (bp):1254Length 2 (bp):1221Length divergence:-0.013
MFE 1 (kcal):-374.04MFE 2 (kcal):-382.84MFE divergence0.012