Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G17100-AT1G78460
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):SOUL heme-binding family protein
Function (paralog2):SOUL heme-binding family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-1.2787476400588
Log2 mRNA fold difference:-0.3094357096125
Log2 TE fold difference:-0.39989369252162
Sequences
Protein sequence

MATGLGFFKLSFLLSLLSGGSDLLGPDAESGVAQIGKFPPSCNRIECPSYELVHSGNGYE
IRRYNNTVWVSTEPIPDISLVDATRTAFFQLFAYIQGKNEYHQKIEMTAPVISQVSPSDG
PFCESSFTVSFYVPKKNQPDPAPSENLHIQKWNSRYVAVRQFSGFVSDDSIGEQAAALDS
SLKGTAWANAIAKSKEDGGVGSDSAYTVAQYNSPFEFSGRVNEIWLPFELDV

METGLNILKLSLCVSLVVVGSYAQAPAPWNPSNGFRPGTCDHYECPTYKLVEAGYGFEIR
MYDAALWISTSPIPSLSMTQATKTGFRRLNRYIEGDNKSNVKMNMTAPVIAQATPGRSVY
TVSLYLPKKNQQNPPQADDLHVRSTKPTYVAVRQIGGYVSNNVAKDEAAALMESLRDSNW
ILPIEKSKGKLPAYFLAVYNPPSHTTARVINEIMVPFNM

www.000webhost.com

Other information
Ka divergence:0.385726KaKs divergence:-0.50506
GC content 1 (%):49GC content 2 (%):49GC content divergence:0
Length 1 (bp):699Length 2 (bp):660Length divergence:-0.029
MFE 1 (kcal):-215.09MFE 2 (kcal):-207.88MFE divergence-0.017