Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G17140-AT1G78430
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):interactor of constitutive active rops 1
Function (paralog2):ROP interactive partner 2

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-3.8898908236631
Log2 mRNA fold difference:-0.54766423834515
Log2 TE fold difference:-3.3742675098556
Sequences
Protein sequence

MPRPRVSELSQRQAPRLRSSSSTSDSNHSNRLITTDQSFKPGVDRKSPRSGGPNSDPLGQ
KKLGGRISDLESQLGQAQEELRLLKEQLANAEAVKKQAQDELHKKSKKPNPLARVEESAT
EAERIDRDEIPGDVQKETDVFEVPVEKIAVEEEELRSGNDEAEKLVAKEDEIKMLKARLY
DMEKEHESLGKENESLKNQLSDSASEISNVKANEDEMVSKVSRIGEELEESRAKTAHLKE
KLESMEEAKDALEAEMKKLRVQTEQWRKAADAAAAVLSGEFEMNGRDRSGSTEKYYAGGF
FDPSAGFMDPPGMADDYDDGLGSGKRKSSGMKMFGELWRKKGQK

MPKPSIRGSELPQRQSPRLRTSLLSTSSDPHHLSRPITDRSPKLGLDRRSPRSGGPHTDP
LSQKKLGSRISGLESQLGQAQEELRLLKQQLAKAEAAKKRAQEELHRKKSKKPNTPAPER
DDIPGDGHQETDVFEVLDEKAKESEKTKNDELASKEDQINVLKARLYDLEKERVSLSEEN
ETLKDQLKKTDTEMSCAKAKEDEIASKVSQIGEELEESNETTAKLKKKLESVEEAKETLE
AEMKKLKVQTEQWRKAADAAAAVLSGGVEMNGRFSEQCGSMEKHFAGRFVGSPGMADDSD
DGSGKRKSSGKKMFGDLWKKKGQK

www.000webhost.com

Other information
Ka divergence:0.0255676KaKs divergence:0.0155786
GC content 1 (%):46GC content 2 (%):47GC content divergence:0.011
Length 1 (bp):1035Length 2 (bp):975Length divergence:-0.03
MFE 1 (kcal):-306.5MFE 2 (kcal):-303.23MFE divergence-0.005