Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G17145-AT1G78420
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):RING/U-box superfamily protein
Function (paralog2):RING/U-box superfamily protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:0.61727125512967
Log2 mRNA fold difference:0.91519490344475
Log2 TE fold difference:-0.35680586090714
Sequences
Protein sequence

MGNKLGRKRQIVDERYTKPQQGLYMSKDVDIKKLKKLILESKLAPCYPGLEETPSSHHDL
EECPICFLYYPSLNRSRCCMKSICTECFLRMKSPNSAQPTQCPFCKTSNYAVEYRGGKTK
EEKSFEQIEEQRVIEAKIRMRQKEVEDDEERMQKRLESYSSSSSTSAATLDTEYGSAAED
DEEIVSSQESCLPSHHPQVTRDGQFDFDLEDIMVMEAIWLSMQEPGIQRNTSPDDISEKD
RNEEPSTPSSSSPSGGLACAIAVLAERQQMVGVSSSNQNVNLASQNLVPDNGNNSHYNAI
EQDSNHYLQGAGISYTRSDMTDDSGGETSREVTWQ

MGNKLGRKRQVVEERYTKPQGLYVNKDVDVKKLRKLIVESKLAPCYPGDDESCHDLEECP
ICFLYYPSLNRSRCCMKSICTECFLQMKNPNSARPTQCPFCKTPNYAVEYRGVKSKEEKG
IEQVEEQRVIEAKIRMRQKEMQDDEEKMQKRLESCSSSTSAMTGEMEYGSTSAISYNSLM
DDGEIAPSQNASVVRQHSRPRGNREDEVDVDLEELMVMEAIWLSVQETGTQRNSASGEIT
SSRQYVTDNHSYVSSPPRVTPIVEPATPSSSSGGLSCAISALAERQMVGESSSHNHNHNV
NVSSYSMLPGNCDSYYDIEQEVDGIDNHHHHRHHYEMGETGSSNSYVSSYMTGEGFHNFP
PPPPLVIVPESFEEQMMMAMAVSMAEVHATTTCAPTEVTWQ

www.000webhost.com

Other information
Ka divergence:-0.13416KaKs divergence:-0.245317
GC content 1 (%):41GC content 2 (%):44GC content divergence:0.035
Length 1 (bp):1008Length 2 (bp):1206Length divergence:0.089
MFE 1 (kcal):-276.1MFE 2 (kcal):-375.79MFE divergence0.153