Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G17170-AT1G78380
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):glutathione S-transferase TAU 24
Function (paralog2):glutathione S-transferase TAU 19

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:3.4332526197132
Log2 mRNA fold difference:3.4933962481368
Log2 TE fold difference:-0.1003539163715
Sequences
Protein sequence

MADEVILLDFWASMFGMRTRIALAEKRVKYDHREEDLWNKSSLLLEMNPVHKKIPVLIHN
GKPVCESLIQIEYIDETWPDNNPLLPSDPYKRAHAKFWADFIDKKVNVTARRIWAVKGEE
QEAAKELIEILKTLESELGDKKYFGDETFGYVDIALIGFHSWFAVYEKFGNVSIESECSK
LVAWAKRCLERESVAKALPESEKVITFISERRKKLGLE

MANEVILLDFWPSMFGMRTRIALREKGVEFEYREEDLRNKSPLLLQMNPIHKKIPVLIHN
GKPVNESIIQVQYIDEVWSHKNPILPSDPYLRAQARFWADFIDKKLYDAQRKVWATKGEE
QEAGKKDFIEILKTLESELGDKPYFSGDDFGYVDIALIGFYTWFPAYEKFANFSIESEVP
KLIAWVKKCLQRESVAKSLPDPEKVTEFVSELRKKFVPE

Other information
Ka divergence:-0.105106KaKs divergence:-0.999823
GC content 1 (%):45GC content 2 (%):44GC content divergence:-0.011
Length 1 (bp):657Length 2 (bp):660Length divergence:0.002
MFE 1 (kcal):-203.5MFE 2 (kcal):-213MFE divergence0.023