Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G17240-AT1G72300
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):receptor like protein 2
Function (paralog2):Leucine-rich receptor-like protein kinase family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:3.8666960633444
Log2 mRNA fold difference:3.5788896614125
Log2 TE fold difference:0.028096133162474
Sequences
Protein sequence

MRSKAKGLVRPLITKPVQPLSSHMHLFLLCILFLSALFLTLSEAVCNLQDRESLIWFSGN
VSSSVSPLNWNLSIDCCSWEGITCDDSSDSHVTVISLPSRGLSGTLASSVQNIHRLSRLD
LSYNRLSGPLPPGFFSTLDQLMILNLSYNSFNGELPLEQAFGNESNRFFSIQTLDLSSNL
LEGEILRSSVYLQGTINLISFNVSNNSFTGPIPSFMCRSSPQLSKLDFSYNDFSGHISQE
LGRCLRLTVLQAGFNNLSGVIPSEIYNLSELEQLFLPANQLTGKIDNNITRLRKLTSLAL
YSNHLEGEIPMDIGNLSSLRSLQLHINNINGTVPLSLANCTKLVKLNLRVNQLGGGLTEL
EFSQLQSLKVLDLGNNSFTGALPDKIFSCKSLTAIRFAGNKLTGEISPQVLELESLSFMG
LSDNKLTNITGALSILQGCRKLSTLILAKNFYDETVPSKEDFLSPDGFPKLRIFGVGACR
LRGEIPAWLINLNKVEVMDLSMNRFVGSIPGWLGTLPDLFYLDLSDNLLTGELPKELFQL
RALMSQKITENNYLELPIFLNPNNVTTNQQYNKLYSFPPTIYIRRNNLTGSIPVEVGQLK
VLHILELLGNNLSGSIPDELSNLTNLERLDLSNNNLSGSIPWSLTNLNFLSYFNVANNSL
EGPIPSEGQFDTFPKANFEGNPLLCGGVLLTSCKPTRAKENDELNRTFLMGIAIGYFLSF
VSILVVRAW

MIDEKMRSKSIGPFVRQVKPLSPHMVLFVLLYVLSISVFFLTVSEAVCNLQDRDSLLWFS
GNVSSPVSPLHWNSSIDCCSWEGISCDKSPENRVTSIILSSRGLSGNLPSSVLDLQRLSR
LDLSHNRLSGPLPPGFLSALDQLLVLDLSYNSFKGELPLQQSFGNGSNGIFPIQTVDLSS
NLLEGEILSSSVFLQGAFNLTSFNVSNNSFTGSIPSFMCTASPQLTKLDFSYNDFSGDLS
QELSRCSRLSVLRAGFNNLSGEIPKEIYNLPELEQLFLPVNRLSGKIDNGITRLTKLTLL
ELYSNHIEGEIPKDIGKLSKLSSLQLHVNNLMGSIPVSLANCTKLVKLNLRVNQLGGTLS
AIDFSRFQSLSILDLGNNSFTGEFPSTVYSCKMMTAMRFAGNKLTGQISPQVLELESLSF
FTFSDNKMTNLTGALSILQGCKKLSTLIMAKNFYDETVPSNKDFLRSDGFPSLQIFGIGA
CRLTGEIPAWLIKLQRVEVMDLSMNRFVGTIPGWLGTLPDLFYLDLSDNFLTGELPKELF
QLRALMSQKAYDATERNYLELPVFVNPNNVTTNQQYNQLSSLPPTIYIKRNNLTGTIPVE
VGQLKVLHILELLGNNFSGSIPDELSNLTNLERLDLSNNNLSGRIPWSLTGLHFLSYFNV
ANNTLSGPIPTGTQFDTFPKANFEGNPLLCGGVLLTSCDPTQHSTTKMGKGKVNRTLVLG
LVLGLFFGVSLILVLLALLVLSKRRVNPGDSENAELEINSNGSYSEVPPGSDKDISLVLL
FGNSRYEVKDLTIFELLKATDNFSQANIIGCGGFGLVYKATLDNGTKLAVKKLTGDYGMM
EKEFKAEVEVLSRAKHENLVALQGYCVHDSARILIYSFMENGSLDYWLHENPEGPAQLDW
PKRLNIMRGASSGLAYMHQICEPHIVHRDIKSSNILLDGNFKAYVADFGLSRLILPYRTH
VTTELVGTLGYIPPEYGQAWVATLRGDVYSFGVVMLELLTGKRPMEVFRPKMSRELVAWV
HTMKRDGKPEEVFDTLLRESGNEEAMLRVLDIACMCVNQNPMKRPNIQQVVDWLKNIEAE
KNQNNREEPEEEEET

Other information
Ka divergence:-0.229583KaKs divergence:-0.282854
GC content 1 (%):43GC content 2 (%):44GC content divergence:0.011
Length 1 (bp):2190Length 2 (bp):3288Length divergence:0.2
MFE 1 (kcal):-606.08MFE 2 (kcal):-995.66MFE divergence0.243