Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G17290-AT1G72330
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):alanine aminotransferas
Function (paralog2):alanine aminotransferase 2

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-3.715407371995
Log2 mRNA fold difference:-3.5592732976944
Log2 TE fold difference:-0.19899419965001
Sequences
Protein sequence

MRRFVIGQAKNLIDQSRRRQLHHHKNLSFVSLIPPFSAPSDSSSRHLSSSSSSDMSASDS
SSSLPVTLDTINPKVIKCEYAVRGEIVNIAQKLQEDLKTNKDAYPFDEIIYCNIGNPQSL
GQQPITFFREVLALCSYTALLDESATHGLFSSDSIERAWKILDQIPGRATGAYSHSQGIK
GLRDAIADGIEARDGFPADPNDIFMTDGASPGVHMMMQLLITSEKDGILCPIPQYPLYSA
SIALHGGTLVPYYLDEASGWGLEISELKKQLEDARSKGITVRALAVINPGNPTGQVLSEE
NQRDVVKFCKQEGLVLLADEVYQENVYVPDKKFHSFKKVARSMGYGEKDLALVSFQSVSK
GYYGECGKRGGYMEVTGFTSDVREQIYKMASVNLCSNISGQILASLIMSPPKPGDDSYES
YIAEKDGILSSLARRAKTLEEALNKLEGVTCNRAEGAMYLFPCLHLPQKAIAAAEAEKTA
PDNFYCKRLLKATGIVVVPGSGFRQVPGTWHFRCTILPQEDKIPAIVDRLTAFHQSFMDE
FRD

MRRFLINQAKGLVDHSRRQHHHKSPSFLSPQPRPLASSPPALSRFFSSTSEMSASDSTSS
LPVTLDSINPKVLKCEYAVRGEIVNIAQKLQEDLKTNKDAYPFDEIIYCNIGNPQSLGQL
PIKFFREVLALCDHASLLDESETHGLFSTDSIDRAWRILDHIPGRATGAYSHSQGIKGLR
DVIAAGIEARDGFPADPNDIFLTDGASPAVTIKTKTLSHRVRVHMMMQLLLSSEKDGILS
PIPQYPLYSASIALHGGSLVPYYLDEATGWGLEISDLKKQLEEARSKGISVRALVVINPG
NPTGQVLAEENQRDIVNFCKQEGLVLLADEVYQENVYVPDKKFHSFKKVARSLGYGEKDI
SLVSFQSVSKGYYGECGKRGGYMEVTGFTSDVREQIYKMASVNLCSNISGQILASLVMSP
PKPGDDSYDSYMAERDGILSSMAKRAKTLEDALNSLEGVTCNRAEGAMYLFPRINLPQKA
IEAAEAEKTAPDAFYCKRLLNATGVVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVNRL
TEFHKSFMDEFRN

Other information
Ka divergence:-0.180405KaKs divergence:0.055339
GC content 1 (%):45GC content 2 (%):44GC content divergence:-0.011
Length 1 (bp):1632Length 2 (bp):1662Length divergence:0.009
MFE 1 (kcal):-486.79MFE 2 (kcal):-495.92MFE divergence0.009