Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G17345-AT1G72430
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):SAUR-like auxin-responsive protein family
Function (paralog2):SAUR-like auxin-responsive protein family

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:5.9177959772647
Log2 mRNA fold difference:5.4705756641966
Log2 TE fold difference:0.63981892737704
Sequences
Protein sequence

MAIFGKLTKLKSAIKKWPSLTKNHHSTMCTASTAVSEVSKCEDLHVVYVGKSRRPYMLSS
HVIAHPLFQELLDRSSRFIEERHDQETVLVACEVVLFEHLLWMLKNSSSDHGDEDDRERG
SVEELAEFYTY

MAKVGKLTKLKSAMKKWPSFAKNHHHSTSSAAVSDELSEDNNLHVVYVGQTRRPYMLRPD
IISHPLFQELVDRSSSRSIEQDREIVVACEVVLFEHLLWMLKSGQEGGSVEELAEFYTY

www.000webhost.com

Other information
Ka divergence:0.00822803KaKs divergence:-0.772915
GC content 1 (%):47GC content 2 (%):46GC content divergence:-0.011
Length 1 (bp):396Length 2 (bp):360Length divergence:-0.048
MFE 1 (kcal):-108.83MFE 2 (kcal):-101.8MFE divergence-0.033