Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G17350-AT1G72420
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):NADH:ubiquinone oxidoreductase intermediate-associated protein 30
Function (paralog2):NADH:ubiquinone oxidoreductase intermediate-associated protein 30

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-1.3199195247217
Log2 mRNA fold difference:-1.9662791310018
Log2 TE fold difference:0.59554405592526
Sequences
Protein sequence

MSRFRSLLQASVNATKKALTWNVEEWVPPAEKHIFKFHSKEDLKKWHLYSDSEYGGLSSA
SLEIPDKGDGSDCTGVFSGNLSVDLSEGSKWNISRSGFCGMRSKKFDGFIDLDGYDAIAL
RIRGDGRCYISTIYTENWVNSPGQSEDNSWQAFVFAPKDSWYTAKASPTTSIDIPLARYL
PTWRGNVIDVEMEMNPGRVLGMSLSVNAEGGAVGAKSGAGDFRQCMIVFVVLGFSL

MSRFRSLWQASVNATKKALTWELEEWVPPVEKCIFKFNSKEDLKTWHLYSDSEYGGLSSA
SLEIKDGGNRSDCNGVFSGNLSTDMREGSKWNINRSGFCGMRSKKFDGFIDLEGYDSIAL
RLKGDGRCYISTIYTENWVNSPGQAEDNSWQAFVFAPKGNWYTAKVPLTRYLPTWKGNVI
DAEMEMNPGHVVGMSLSVNAQGGGFIGAKSGAGDFQVEIDWIKAVRMP

Other information
Ka divergence:-0.106187KaKs divergence:0.111226
GC content 1 (%):42GC content 2 (%):43GC content divergence:0.012
Length 1 (bp):711Length 2 (bp):687Length divergence:-0.017
MFE 1 (kcal):-214MFE 2 (kcal):-196.9MFE divergence-0.042