Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G17360-AT1G72410
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):COP1-interacting protein-related

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.69767141573525
Log2 mRNA fold difference:0.050664288418136
Log2 TE fold difference:-0.67100149199036
Sequences
Protein sequence

MKADTVLDYAVFELSPKYSRCELFVSSNEEREKLASGLIEPFVNHLRVIESQASKRDQSS
VRLEVEQSENGESWFTRRTLERFVQYVNSPEVLERVNTFDLEMSQLEAARTLYSQDDGGV
ADATQKELVRAIDLRLEAIKKDLTTAIAHASANGFDPQTVSDLQRFADRFGAHHLNEACS
KYISLSQRRPDLITKNVNTNTRTSVDETNISQQLSTKNDKEENKDESLDESSTVKPIHHT
RRLSVQDRINLFESKQKENSNSAGNKPVVVAKSTELKRPSSDTSSTVPAFPEKSVLRRWS
IVSDMSFDFTMENKKSDSGSNEEGPLSTPSSIPDATFPKESEENSKKDDDDVYSTISDDS
QNQIDKPGNFMTDGNSMPREDESYASKSHNVAQSSVMFPYRHSRSRSAHIAGGIDIKSDE
RQSKGRKKELFPSDKKQALTSPPKPVSAGSEQRQKSFGVEDDLVNADAAGKFDKNRVRAT
SVDQTQRTRMPRESPPGFNDELKIKAQDLEKIFAEHQLRILPGDQSAGNDKDNGNVVMRR
NLSELRFSDDSKGKLYEEYMKKRDAKLREEWSSKESKLKSMQEALDQSRTEMKAKFSAAS
MKRQDSISSTRQRAEKFRSFNSRTSSKKYQHPISSLQSEEENEKDKLVSGQSIGKGASKS
SQVRKVPSPNGSSRVSKPSGKVSNTNTNTSGRGRKTSEIKLVTQSSLPKFSDLKKENTKP
SSLAGRNTTTMMRTQARNGNKKTTKEDIPSPVMPRRPRSLRKSFSANIEFTELTTLYSDD
MMNKERNQKQNTDIDDVSENLKNEAFDDTESEAEEEEKEVLENPVKGEEEAREMETLVVE
EDIGDETPSLTEIVENSSENENYTSLRSVSHVDLQANTLPSSTLQHNVASLFDSPSESPL
SWSSNLQHAFSYPHEHSDVDASVDDSPMGSPASWSSRMRKKWGTTAQSPVIVPNSRKDLT
KGIKRFLKFGKKTRAADSLMDWVSVTTSEGDDDCAYRSSDELRKSRMASSQSQLSEDEQA
SNNMIQPHHHQASFKVKDGDFKRSFFSLSTFRSKGNDSKPR

MRSDTVLDYVVFELSPKHSKCELFVSSNEQTEKLASGLIQPFVNHLKVLEAKASPVAQSS
IRLEVEKSNTWFTKRTLERFVQFVNSPETLEKVNTYYSEMLQLEAARTLYSQRSEDSKFG
ASDDGAAADATKKELLKAIDLRLEAIKKDLTTSISHASASGFDPHTVSELKQFADRFSAH
HLDEACSKYISLWKQRPDLIDMKYSNQLAGVDNVSLQKDSTRQKQNAVNESEHQIQQCAT
TSTKRNEEEKTDDSLDVTSSTVKTTQHTRRLSVQDRINLFENKQKENSPSGGSKPVAVTK
STELRRLSSDVSSSEKPILRRSSIVSDMSTDLASEKKLESFPEDPSSTSSSLPHTIAQPN
FNESVKKDDEVKYELKSDSEKVGDEEASRDRVESSKTVTETRLVSGVEATSYVQSRSVID
PNVSSASQNQTERHVDRLQNVMSDAKSRQREEGYEHKANNVSQSSAMFPSRHTRSQSAHI
EASFKEDVASQPQSRYSFGRIKKKEVVPSDEQPVLPQKPQFNVRDGPDDGEGRQVRANSS
RFPPASVDQIQRTRLSKENPGANDELKLKANELEKLFAEHQLRVPGDQSSSSRRGKSSEN
QVAHKEPSHSIAATEKRLSLGGGSADFSKLMTPLVGDKDKGDALRRNLSDLSLTDDSKGK
FYEKYMKKRDAKLREEWSLKKGEKETKLKSMQEALEQSRTEMKAKLSASSSERKDLLSST
RQRAEKFRSFNSRSSMKKYQSEEDEDISEQKPRAKDKAASGQQSVGSISSRSSQARKLQP
NRNMSSSITPRSAASVPKPSGKVSNTSSGRRRSDKSLAQSVPNFSELIKENTKPSSLAVK
TTMRSQVKSSGRTKNIKEDTLLQRPRSLRKSSSGNIDFTELSTLCSDDMMVSLRVDSDIS
ETLRNEEYDEPEAEPEEVLENAVREEEEVEELETLVFEDGNPMLSEAYEKVDHSGEENCS
FLPATVPTTLLASLMDSPGESPLSWNANLQHSFSYPHEHSSDVDASVDSPTGSPASWSSR
MRKKWGTAQTPVTVAAANNMSQYQSKKDLSKGFKRLLKFGRKSRGAESLMMDWVSVTTSE
GDDEVEDRRDFADRSSEDLRKSRMGSLQNHLSEDGFNESEFPEQASNTELKDDHQMSGSN
FKVVLFLLLQRKSHSSRSPHSAAKEMIRSQDREQTKKEETWMWIKLRDEQELINPIFCNY
IVILAILKNPICFWPSFTNILMHIHKYSRASGWATKSFFISPTNHIAEIVVCISNFSSHV
YKVAVANHNN

Other information
Ka divergence:-0.0432976KaKs divergence:0.0275648
GC content 1 (%):40GC content 2 (%):42GC content divergence:0.024
Length 1 (bp):3186Length 2 (bp):3813Length divergence:0.09
MFE 1 (kcal):-865.71MFE 2 (kcal):-1115.76MFE divergence0.126