Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G17380-AT1G72450
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):jasmonate-zim-domain protein 5
Function (paralog2):jasmonate-zim-domain protein 6

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.7937824195121
Log2 mRNA fold difference:1.6083560217681
Log2 TE fold difference:-0.048413886431197
Sequences
Protein sequence

MSSSNENAKAQAPEKSDFTRRCSLLSRYLKEKGSFGNIDLGLYRKPDSSLALPGKFDPPG
KQNAMHKAGHSKGEPSTSSGGKVKDVADLSESQPGSSQLTIFFGGKVLVYNEFPVDKAKE
IMEVAKQAKPVTEINIQTPINDENNNNKSSMVLPDLNEPTDNNHLTKEQQQQQEQNQIVE
RIARRASLHRFFAKRKDRAVARAPYQVNQNAGHHRYPPKPEIVTGQPLEAGQSSQRPPDN
AIGQTMAHIKSDGDKDDIMKIEEGQSSKDLDLRL

MSTGQAPEKSNFSQRCSLLSRYLKEKGSFGNINMGLARKSDLELAGKFDLKGQQNVIKKV
ETSETRPFKLIQKFSIGEASTSTEDKAIYIDLSEPAKVAPESGNSQLTIFFGGKVMVFNE
FPEDKAKEIMEVAKEANHVAVDSKNSQSHMNLDKSNVVIPDLNEPTSSGNNEDQETGQQH
QVVERIARRASLHRFFAKRKDRAVARAPYQVNQHGSHLPPKPEMVAPSIKSGQSSQHIAT
PPKPKAHNHMPMEVDKKEGQSSKNLELKL

www.000webhost.com

Other information
Ka divergence:-0.232727KaKs divergence:0.807083
GC content 1 (%):45GC content 2 (%):43GC content divergence:-0.023
Length 1 (bp):825Length 2 (bp):810Length divergence:-0.009
MFE 1 (kcal):-216.6MFE 2 (kcal):-218.54MFE divergence0.004